NO12G00420, NO12G00420 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO12G00420 vs. NCBI_GenBank
Match: KRT81606.1 (Regulator of chromosome condensation repeat containing protein [Oryctes borbonicus]) HSP 1 Score: 69.3 bits (168), Expect = 6.300e-8 Identity = 35/68 (51.47%), Postives = 42/68 (61.76%), Query Frame = 0 Query: 497 EVYSWGCGLYHALGHGKRANSWRPHLVEALEGIGGMRKDGRCMSGIQAIAAGGWHSAALSVTGEVYGW 565 +VYS+GCGL LGHG N P L+EAL G+ IQ IAAGGWHS A+SVTG++Y W Sbjct: 167 DVYSFGCGLRGQLGHGTLENETNPTLIEALAGV-----------KIQKIAAGGWHSCAISVTGDLYTW 223
BLAST of NO12G00420 vs. NCBI_GenBank
Match: XP_009829623.1 (hypothetical protein H257_06184 [Aphanomyces astaci] >ETV80676.1 hypothetical protein H257_06184 [Aphanomyces astaci]) HSP 1 Score: 68.2 bits (165), Expect = 1.400e-7 Identity = 30/67 (44.78%), Postives = 46/67 (68.66%), Query Frame = 0 Query: 498 VYSWGCGLYHALGHGKRANSWRPHLVEALEGIGGMRKDGRCMSGIQAIAAGGWHSAALSVTGEVYGW 565 +Y++G GLYH LGHG N + P V +LEG+G ++++ +G+ +A G WH+AAL+ TG+VY W Sbjct: 180 LYTFGWGLYHQLGHGTTNNVFTPTRVRSLEGVGQLQRNH--FTGLARVACGAWHTAALTTTGDVYTW 244
BLAST of NO12G00420 vs. NCBI_GenBank
Match: XP_009829624.1 (hypothetical protein, variant [Aphanomyces astaci] >ETV80677.1 hypothetical protein, variant [Aphanomyces astaci]) HSP 1 Score: 68.2 bits (165), Expect = 1.400e-7 Identity = 30/67 (44.78%), Postives = 46/67 (68.66%), Query Frame = 0 Query: 498 VYSWGCGLYHALGHGKRANSWRPHLVEALEGIGGMRKDGRCMSGIQAIAAGGWHSAALSVTGEVYGW 565 +Y++G GLYH LGHG N + P V +LEG+G ++++ +G+ +A G WH+AAL+ TG+VY W Sbjct: 180 LYTFGWGLYHQLGHGTTNNVFTPTRVRSLEGVGQLQRNH--FTGLARVACGAWHTAALTTTGDVYTW 244
BLAST of NO12G00420 vs. NCBI_GenBank
Match: OQR87793.1 (ultraviolet-B receptor UVR8 [Achlya hypogyna]) HSP 1 Score: 67.0 bits (162), Expect = 3.100e-7 Identity = 31/68 (45.59%), Postives = 44/68 (64.71%), Query Frame = 0 Query: 497 EVYSWGCGLYHALGHGKRANSWRPHLVEALEGIGGMRKDGRCMSGIQAIAAGGWHSAALSVTGEVYGW 565 E+Y+ G GLYH LGHG A+ + P V +L G+G R DG SG+ ++ G WH+ AL+ TG++Y W Sbjct: 176 ELYTMGWGLYHQLGHGSTADLFAPECVTSLLGVGDYR-DG-AFSGLTQVSCGAWHTVALTTTGDIYTW 241 The following BLAST results are available for this feature:
BLAST of NO12G00420 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 4
Relationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO12G00420 ID=NO12G00420|Name=NO12G00420|organism=Nannochloropsis oceanica|type=gene|length=3181bpback to top protein sequence of NO12G00420.1 >NO12G00420.1-protein ID=NO12G00420.1-protein|Name=NO12G00420.1|organism=Nannochloropsis oceanica|type=polypeptide|length=826bpback to top Synonyms
Publications
|