NO03G03160, NO03G03160 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO03G03160 vs. NCBI_GenBank
Match: XP_005853405.1 (cytochrome c oxidase biogenesis protein cmc1-like protein [Nannochloropsis gaditana CCMP526] >EKU22954.1 cytochrome c oxidase biogenesis protein cmc1-like protein [Nannochloropsis gaditana CCMP526]) HSP 1 Score: 117.5 bits (293), Expect = 2.100e-23 Identity = 52/70 (74.29%), Postives = 62/70 (88.57%), Query Frame = 0 Query: 15 VIDALLSCHRQHPLAKFWGACNEEKWALDKCFRVEKEDRRKQNFAKAPRDDGAWSKIVAQKEAQVQAEKE 85 VIDALL CH++HP AKFWG CNE+KWALDKCFR+EKE RR+ NFA A RDDGAWS+IV QKEA+++A+KE Sbjct: 2 VIDALLLCHQEHPWAKFWGECNEQKWALDKCFRMEKEQRRRANFAVASRDDGAWSQIVKQKEAELRAKKE 71
BLAST of NO03G03160 vs. NCBI_GenBank
Match: XP_009036364.1 (hypothetical protein AURANDRAFT_25383 [Aureococcus anophagefferens] >EGB09260.1 hypothetical protein AURANDRAFT_25383 [Aureococcus anophagefferens]) HSP 1 Score: 91.7 bits (226), Expect = 1.200e-15 Identity = 37/70 (52.86%), Postives = 50/70 (71.43%), Query Frame = 0 Query: 1 MHPPLHRPHPDCQHVIDALLSCHRQHPLAKFWGACNEEKWALDKCFRVEKEDRRKQNFAKAPRDDGAWSK 71 MHPPL+RPHP C ++D L+ CH ++P KFWGACN+EK A+D CF+ EKE++R+ NF K + W K Sbjct: 1 MHPPLYRPHPKCAALVDLLVKCHDENPYGKFWGACNDEKAAMDWCFKEEKEEKRRANFEKTRSFNEEWRK 70
BLAST of NO03G03160 vs. NCBI_GenBank
Match: CCA22679.1 (unnamed protein product putative [Albugo laibachii Nc14]) HSP 1 Score: 88.6 bits (218), Expect = 1.000e-14 Identity = 40/61 (65.57%), Postives = 46/61 (75.41%), Query Frame = 0 Query: 1 MHPPLHRPHPDCQHVIDALLSCHRQHPLAKFWGACNEEKWALDKCFRVEKEDRRKQNFAKA 62 MHPPL RPHP CQ VI L CH ++P AKF GACNE K ALD CFR+EKE++RKQN K+ Sbjct: 1 MHPPLDRPHPLCQQVIKNLKQCHTENPRAKFLGACNEAKRALDDCFRMEKEEKRKQNLVKS 61
BLAST of NO03G03160 vs. NCBI_GenBank
Match: GAX94696.1 (Hypothetical protein PINS_002589 [Pythium insidiosum]) HSP 1 Score: 88.2 bits (217), Expect = 1.400e-14 Identity = 44/86 (51.16%), Postives = 58/86 (67.44%), Query Frame = 0 Query: 1 MHPPLHRPHPDCQHVIDALLSCHRQHPLAKFWGACNEEKWALDKCFRVEKEDRRKQNFAKAPRDDGAWSKIVAQKEAQVQAEKESQ 87 MHP L R HPDCQ VI+AL++CH Q+P+AKF+GAC+E K ALDKCFR EK RR +N +A D V QK + + +E++ Sbjct: 1 MHPSLDRDHPDCQDVIEALVTCHEQNPMAKFFGACSEAKVALDKCFRTEKIKRRTENLERARASDA----YVRQKMKEHRERREAE 82
BLAST of NO03G03160 vs. NCBI_GenBank
Match: GBG29975.1 (COX assembly mitochondrial protein 2 [Aurantiochytrium sp. FCC1311]) HSP 1 Score: 84.3 bits (207), Expect = 2.000e-13 Identity = 42/81 (51.85%), Postives = 50/81 (61.73%), Query Frame = 0 Query: 1 MHPPLHRPHPDCQHVIDALLSCHRQHPLAKFWGACNEEKWALDKCFRVEKEDRRKQNFAKAPRDDGAWSKIVAQKEAQVQA 82 MHPPL RPHP CQ VIDAL CH +P KF G+CNE K ALD+CFR EKE RK N +A + +A+ A+ A Sbjct: 1 MHPPLDRPHPYCQDVIDALRKCHEDNPYMKFLGSCNEPKAALDQCFRAEKEVMRKANAERARESRRRAEERMARDRAEASA 81
BLAST of NO03G03160 vs. NCBI_GenBank
Match: XP_009530838.1 (hypothetical protein PHYSODRAFT_547087 [Phytophthora sojae] >EGZ13409.1 hypothetical protein PHYSODRAFT_547087 [Phytophthora sojae]) HSP 1 Score: 83.6 bits (205), Expect = 3.400e-13 Identity = 41/86 (47.67%), Postives = 56/86 (65.12%), Query Frame = 0 Query: 1 MHPPLHRPHPDCQHVIDALLSCHRQHPLAKFWGACNEEKWALDKCFRVEKEDRRKQNFAKAPRDDGAWSKIVAQKEAQVQAEKESQ 87 MH PL RPHPDCQ I ALL CH ++P AKF+GAC + K ALD CFR EK R +NF +A D + + ++ +V AE++++ Sbjct: 1 MHTPLDRPHPDCQAEIKALLECHEENPYAKFFGACGDVKTALDWCFREEKVRIRSENFQRAKASDAYVRQKMQERRDRVAAEQKAK 86
BLAST of NO03G03160 vs. NCBI_GenBank
Match: POM70309.1 (Hypothetical protein PHPALM_13268 [Phytophthora palmivora var. palmivora]) HSP 1 Score: 82.8 bits (203), Expect = 5.800e-13 Identity = 41/86 (47.67%), Postives = 54/86 (62.79%), Query Frame = 0 Query: 1 MHPPLHRPHPDCQHVIDALLSCHRQHPLAKFWGACNEEKWALDKCFRVEKEDRRKQNFAKAPRDDGAWSKIVAQKEAQVQAEKESQ 87 MH PL RPHPDCQ I ALL CH +P AKF+GAC + K ALD CFR EK R +NF A D + + ++ +V AE++++ Sbjct: 1 MHTPLDRPHPDCQTEIKALLECHESNPYAKFFGACGDVKTALDICFREEKNRIRSENFKHAKASDAYVKQKMQERRDRVAAEEKAR 86
BLAST of NO03G03160 vs. NCBI_GenBank
Match: XP_008911220.1 (hypothetical protein PPTG_15681 [Phytophthora parasitica INRA-310] >ETI38031.1 hypothetical protein F443_16129 [Phytophthora parasitica P1569] >ETK78245.1 hypothetical protein L915_15675 [Phytophthora parasitica] >ETL31680.1 hypothetical protein L916_15570 [Phytophthora parasitica] >ETL84910.1 hypothetical protein L917_15393 [Phytophthora parasitica] >ETM38093.1 hypothetical protein L914_15525 [Phytophthora parasitica] >ETN03447.1 hypothetical protein PPTG_15681 [Phytophthora parasitica INRA-310] >ETO66800.1 hypothetical protein F444_16114 [Phytophthora parasitica P1976] >ETP07921.1 hypothetical protein F441_15958 [Phytophthora parasitica CJ01A1] >ETP35951.1 hypothetical protein F442_15982 [Phytophthora parasitica P10297]) HSP 1 Score: 82.4 bits (202), Expect = 7.500e-13 Identity = 41/86 (47.67%), Postives = 54/86 (62.79%), Query Frame = 0 Query: 1 MHPPLHRPHPDCQHVIDALLSCHRQHPLAKFWGACNEEKWALDKCFRVEKEDRRKQNFAKAPRDDGAWSKIVAQKEAQVQAEKESQ 87 MH PL RPHPDCQ I ALL CH +P AKF+GAC E K ALD CF+ EK R +NF A D + + ++ +V AE++++ Sbjct: 1 MHAPLDRPHPDCQAEIKALLECHENNPYAKFFGACGEVKTALDHCFKNEKIRMRSENFKHAKASDAYVRQKMQERRDRVAAEEKAR 86
BLAST of NO03G03160 vs. NCBI_GenBank
Match: CCI10540.1 (unnamed protein product [Albugo candida]) HSP 1 Score: 82.4 bits (202), Expect = 7.500e-13 Identity = 37/61 (60.66%), Postives = 44/61 (72.13%), Query Frame = 0 Query: 1 MHPPLHRPHPDCQHVIDALLSCHRQHPLAKFWGACNEEKWALDKCFRVEKEDRRKQNFAKA 62 MHPPL RPHP CQ VI L CH +P KF GACNE K ALD+CFR EKE++R+QN ++ Sbjct: 1 MHPPLDRPHPLCQKVIQNLKKCHADNPRRKFIGACNEAKRALDECFRKEKEEKRRQNLRRS 61
BLAST of NO03G03160 vs. NCBI_GenBank
Match: OWZ02784.1 (hypothetical protein PHMEG_00025590 [Phytophthora megakarya]) HSP 1 Score: 82.4 bits (202), Expect = 7.500e-13 Identity = 42/83 (50.60%), Postives = 51/83 (61.45%), Query Frame = 0 Query: 1 MHPPLHRPHPDCQHVIDALLSCHRQHPLAKFWGACNEEKWALDKCFRVEKEDRRKQNFAKAPRDDGAWSKIVAQKEAQVQAEK 84 MH PL RPHPDCQ I ALL CH ++P AKF+GAC E K ALD CFR EK R +NF A D + + ++ +V EK Sbjct: 1 MHTPLDRPHPDCQTEIKALLECHDENPYAKFFGACGEIKTALDICFREEKNRIRSENFKHAKASDAYVKQKMQERRDRVANEK 83 The following BLAST results are available for this feature:
BLAST of NO03G03160 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 20
Pagesback to topRelationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO03G03160 ID=NO03G03160|Name=NO03G03160|organism=Nannochloropsis oceanica|type=gene|length=746bpback to top protein sequence of NO03G03160.1 >NO03G03160.1-protein ID=NO03G03160.1-protein|Name=NO03G03160.1|organism=Nannochloropsis oceanica|type=polypeptide|length=87bpback to top Synonyms
Publications
|