NO02G03580, NO02G03580 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO02G03580 vs. NCBI_GenBank
Match: OEU08909.1 (hypothetical protein FRACYDRAFT_155578, partial [Fragilariopsis cylindrus CCMP1102]) HSP 1 Score: 94.7 bits (234), Expect = 2.100e-16 Identity = 38/60 (63.33%), Postives = 50/60 (83.33%), Query Frame = 0 Query: 59 KINNKVDLESPKVVTMVEMKPGEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIVS 119 KIN +DL++ KVV M ++ G+K V+CRCW+SGTFPLCDG H+ HN+ATGDN+GPLIV+ Sbjct: 1 KINTLIDLDAEKVVNMEKLDAGKKAVYCRCWKSGTFPLCDGNHVAHNKATGDNVGPLIVT 60
BLAST of NO02G03580 vs. NCBI_GenBank
Match: XP_002288968.1 (predicted protein, partial [Thalassiosira pseudonana CCMP1335] >EED94404.1 predicted protein, partial [Thalassiosira pseudonana CCMP1335]) HSP 1 Score: 94.0 bits (232), Expect = 3.600e-16 Identity = 38/61 (62.30%), Postives = 50/61 (81.97%), Query Frame = 0 Query: 58 AKINNKVDLESPKVVTMVEMKPGEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIVS 119 AKIN K+DL+S KVV ++ G+KKV+CRCW+S TFPLCDGAH+ HN+ GDN+GPLI++ Sbjct: 1 AKINGKIDLDSAKVVNQEQLCVGDKKVYCRCWKSETFPLCDGAHVAHNKEKGDNVGPLILT 61
BLAST of NO02G03580 vs. NCBI_GenBank
Match: ACO11206.1 (CDGSH iron sulfur domain-containing protein 2 homolog [Caligus rogercresseyi]) HSP 1 Score: 90.5 bits (223), Expect = 4.000e-15 Identity = 40/66 (60.61%), Postives = 49/66 (74.24%), Query Frame = 0 Query: 57 QAKINNKVDLESPKVVTMVEMKP-GEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIVSTPK 122 Q K+N + LES KVV V+++ G+K VFCRCW+S FP CDGAH KHNE TGDN+GPLIV+ K Sbjct: 53 QYKVNKSIKLESDKVVDTVDIEDIGDKSVFCRCWKSKKFPYCDGAHNKHNEKTGDNVGPLIVAKKK 118
BLAST of NO02G03580 vs. NCBI_GenBank
Match: ACO15461.1 (CDGSH iron sulfur domain-containing protein 2 homolog [Caligus clemensi]) HSP 1 Score: 89.0 bits (219), Expect = 1.200e-14 Identity = 38/64 (59.38%), Postives = 49/64 (76.56%), Query Frame = 0 Query: 59 KINNKVDLESPKVVTMVEMKP-GEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIVSTPK 122 K+NN + L+S KVV V+++ G+K VFCRCW+S FP CDG+H KHN+ TGDN+GPLIVS K Sbjct: 82 KLNNSIKLDSDKVVDTVDIEDIGDKSVFCRCWKSKKFPYCDGSHNKHNKQTGDNVGPLIVSNKK 145
BLAST of NO02G03580 vs. NCBI_GenBank
Match: XP_013300550.1 (zinc finger CDGSH type [Necator americanus] >ETN78323.1 zinc finger CDGSH type [Necator americanus]) HSP 1 Score: 89.0 bits (219), Expect = 1.200e-14 Identity = 39/64 (60.94%), Postives = 49/64 (76.56%), Query Frame = 0 Query: 55 LCQAKINNKVDLESPKVVTMVEMKP-GEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIV 118 L +A++N+KV L + KVV V+M+ GEKK FCRCW+S FP CDGAH +HN TGDN+GPLIV Sbjct: 72 LRKARVNSKVQLANDKVVDTVDMEDIGEKKAFCRCWKSEKFPYCDGAHTRHNNETGDNVGPLIV 135
BLAST of NO02G03580 vs. NCBI_GenBank
Match: ADD37940.1 (CDGSH iron sulfur domain-containing protein 2 homolog [Lepeophtheirus salmonis]) HSP 1 Score: 88.6 bits (218), Expect = 1.500e-14 Identity = 40/70 (57.14%), Postives = 51/70 (72.86%), Query Frame = 0 Query: 55 LCQA--KINNKVDLESPKVVTMVEMKP-GEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIVSTPK 122 LC+A K+N + L+S KVV ++++ G+K VFCRCW+S FP CDGAH KHNE TGDNIGP+IV K Sbjct: 76 LCKAQYKVNKSIKLDSNKVVDSIDIEDIGDKSVFCRCWKSKKFPYCDGAHNKHNETTGDNIGPIIVQKGK 145
BLAST of NO02G03580 vs. NCBI_GenBank
Match: XP_006032467.1 (PREDICTED: CDGSH iron-sulfur domain-containing protein 1 isoform X1 [Alligator sinensis] >XP_019363319.1 PREDICTED: CDGSH iron-sulfur domain-containing protein 1 isoform X1 [Gavialis gangeticus] >XP_019394130.1 PREDICTED: CDGSH iron-sulfur domain-containing protein 1 isoform X1 [Crocodylus porosus]) HSP 1 Score: 87.8 bits (216), Expect = 2.600e-14 Identity = 36/63 (57.14%), Postives = 48/63 (76.19%), Query Frame = 0 Query: 56 CQAKINNKVDLESPKVVTMVEMKP-GEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIV 118 C+A +N + ++PKVV +M+ GEK V+CRCW+S FPLCDG+H KHNE TGDN+GPLI+ Sbjct: 41 CKAMVNLHIQKDNPKVVHAFDMEDLGEKAVYCRCWRSKKFPLCDGSHTKHNEETGDNVGPLII 103
BLAST of NO02G03580 vs. NCBI_GenBank
Match: XP_006032468.1 (PREDICTED: CDGSH iron-sulfur domain-containing protein 1 isoform X2 [Alligator sinensis] >XP_019363320.1 PREDICTED: CDGSH iron-sulfur domain-containing protein 1 isoform X2 [Gavialis gangeticus] >XP_019394131.1 PREDICTED: CDGSH iron-sulfur domain-containing protein 1 isoform X2 [Crocodylus porosus]) HSP 1 Score: 87.8 bits (216), Expect = 2.600e-14 Identity = 36/63 (57.14%), Postives = 48/63 (76.19%), Query Frame = 0 Query: 56 CQAKINNKVDLESPKVVTMVEMKP-GEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIV 118 C+A +N + ++PKVV +M+ GEK V+CRCW+S FPLCDG+H KHNE TGDN+GPLI+ Sbjct: 36 CKAMVNLHIQKDNPKVVHAFDMEDLGEKAVYCRCWRSKKFPLCDGSHTKHNEETGDNVGPLII 98
BLAST of NO02G03580 vs. NCBI_GenBank
Match: KTG35902.1 (hypothetical protein cypCar_00040806 [Cyprinus carpio]) HSP 1 Score: 87.8 bits (216), Expect = 2.600e-14 Identity = 36/67 (53.73%), Postives = 48/67 (71.64%), Query Frame = 0 Query: 57 QAKINNKVDLESPKVVTMVEMKP-GEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIVSTPKP 123 ++++N +D +SPKVV +M+ G K V+CRCW+S FP CDGAH KHNE TGDN+GPLI+ P Sbjct: 36 KSRVNMSIDKDSPKVVHSFDMEDIGNKAVYCRCWRSKKFPYCDGAHTKHNEETGDNVGPLIIKKKNP 102
BLAST of NO02G03580 vs. NCBI_GenBank
Match: XP_015912094.1 (CDGSH iron-sulfur domain-containing protein 1-like isoform X1 [Parasteatoda tepidariorum]) HSP 1 Score: 87.8 bits (216), Expect = 2.600e-14 Identity = 36/62 (58.06%), Postives = 49/62 (79.03%), Query Frame = 0 Query: 57 QAKINNKVDLESPKVVTMVEMKP-GEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIV 118 + ++N+K+D++ KVV V+++ G KKVFCRCW+S FP CDG+H KHNE TGDN+GPLIV Sbjct: 33 KGRVNDKIDMDCNKVVHSVDIEDIGNKKVFCRCWKSSKFPYCDGSHTKHNEDTGDNLGPLIV 94 The following BLAST results are available for this feature:
BLAST of NO02G03580 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 20
Pagesback to topRelationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO02G03580 ID=NO02G03580|Name=NO02G03580|organism=Nannochloropsis oceanica|type=gene|length=1914bpback to top protein sequence of NO02G03580.2 >NO02G03580.2-protein ID=NO02G03580.2-protein|Name=NO02G03580.2|organism=Nannochloropsis oceanica|type=polypeptide|length=125bpback to top protein sequence of NO02G03580.1 >NO02G03580.1-protein ID=NO02G03580.1-protein|Name=NO02G03580.1|organism=Nannochloropsis oceanica|type=polypeptide|length=130bpback to top Synonyms
Publications
|