NO02G03580, NO02G03580 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO02G03580 vs. NCBI_GenBank
Match: XP_002294522.1 (predicted protein, partial [Thalassiosira pseudonana CCMP1335] >EED88356.1 predicted protein, partial [Thalassiosira pseudonana CCMP1335]) HSP 1 Score: 104.8 bits (260), Expect = 2.000e-19 Identity = 44/64 (68.75%), Postives = 54/64 (84.38%), Query Frame = 0 Query: 58 AKINNKVDLESPKVVTMVEMKPGEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIVSTPK 122 A+INNK+DL+SPKV TM ++ GEKKV+CRCW+S TFPLCD AH+ HN+ TGDN+GPLIVS K Sbjct: 2 ARINNKIDLDSPKVATMDKICDGEKKVYCRCWKSETFPLCDAAHVAHNKETGDNVGPLIVSVEK 65
BLAST of NO02G03580 vs. NCBI_GenBank
Match: CBN80293.1 (CDGSH iron sulfur domain-containing protein [Ectocarpus siliculosus]) HSP 1 Score: 104.0 bits (258), Expect = 3.500e-19 Identity = 46/64 (71.88%), Postives = 54/64 (84.38%), Query Frame = 0 Query: 59 KINN-KVDLESPKVVTMVEMKPGEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIVSTPK 122 KIN + +L+ PKVVTM + G KKV+CRCW+SGTFPLCDGAH+KHNEATGDN+GPLIVS PK Sbjct: 37 KINTIEFELDKPKVVTMDSVDAGGKKVYCRCWKSGTFPLCDGAHVKHNEATGDNVGPLIVSGPK 100
BLAST of NO02G03580 vs. NCBI_GenBank
Match: XP_005830934.1 (hypothetical protein GUITHDRAFT_72700 [Guillardia theta CCMP2712] >EKX43954.1 hypothetical protein GUITHDRAFT_72700 [Guillardia theta CCMP2712]) HSP 1 Score: 101.7 bits (252), Expect = 1.700e-18 Identity = 40/63 (63.49%), Postives = 53/63 (84.13%), Query Frame = 0 Query: 59 KINNKVDLESPKVVTMVEMKPGEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIVSTPK 122 KIN+K++L++PKV T ++PG+K V+CRCW+S TFP CDGAH KHN+ TGDN+GPLIV+ PK Sbjct: 4 KINHKIELDNPKVATTDTIEPGQKVVYCRCWKSATFPKCDGAHNKHNQETGDNVGPLIVNVPK 66
BLAST of NO02G03580 vs. NCBI_GenBank
Match: CEM37796.1 (unnamed protein product [Vitrella brassicaformis CCMP3155]) HSP 1 Score: 99.4 bits (246), Expect = 8.500e-18 Identity = 43/60 (71.67%), Postives = 49/60 (81.67%), Query Frame = 0 Query: 59 KINNKVDLESPKVVTMVEMKPGEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIVS 119 KIN VD ESPKVV ++ G+KKV+CRCW SGTFP+CDG H KHNEATGDN+GPLIVS Sbjct: 53 KINLSVDPESPKVVHQEKIPTGKKKVYCRCWLSGTFPVCDGTHAKHNEATGDNVGPLIVS 112
BLAST of NO02G03580 vs. NCBI_GenBank
Match: GAX21812.1 (hypothetical protein FisN_30Hh011 [Fistulifera solaris]) HSP 1 Score: 98.6 bits (244), Expect = 1.500e-17 Identity = 44/62 (70.97%), Postives = 49/62 (79.03%), Query Frame = 0 Query: 57 QAKINNKVDLESPKVVTMVEMKPGEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIVS 119 + KIN +DLESPKV M EM G KKVFCRCW SGTFPLCDG H+KHN A GDN+GPLIV+ Sbjct: 42 EGKINLLIDLESPKVANMEEMSSG-KKVFCRCWLSGTFPLCDGTHVKHNAACGDNVGPLIVT 102
BLAST of NO02G03580 vs. NCBI_GenBank
Match: GAX11636.1 (hypothetical protein FisN_30Lh011 [Fistulifera solaris]) HSP 1 Score: 98.6 bits (244), Expect = 1.500e-17 Identity = 44/62 (70.97%), Postives = 49/62 (79.03%), Query Frame = 0 Query: 57 QAKINNKVDLESPKVVTMVEMKPGEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIVS 119 + KIN +DLESPKV M EM G KKVFCRCW SGTFPLCDG H+KHN A GDN+GPLIV+ Sbjct: 42 EGKINLLIDLESPKVANMEEMSSG-KKVFCRCWLSGTFPLCDGTHVKHNAACGDNVGPLIVT 102
BLAST of NO02G03580 vs. NCBI_GenBank
Match: XP_002176131.1 (predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1] >EEC42882.1 predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]) HSP 1 Score: 98.2 bits (243), Expect = 1.900e-17 Identity = 42/59 (71.19%), Postives = 50/59 (84.75%), Query Frame = 0 Query: 63 KVDLESPKVVTMVEMKPGEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIVSTPK 122 K+DL+SPKV TM +++ G KKV+CRCW SGTFPLCDG H KHN+ATGDN+GPLIVS K Sbjct: 1 KIDLDSPKVATMDDIEKG-KKVYCRCWLSGTFPLCDGTHQKHNDATGDNVGPLIVSVKK 58
BLAST of NO02G03580 vs. NCBI_GenBank
Match: OEU06071.1 (iron-sulfur domain-containing NEET-like protein [Fragilariopsis cylindrus CCMP1102]) HSP 1 Score: 96.7 bits (239), Expect = 5.500e-17 Identity = 39/64 (60.94%), Postives = 52/64 (81.25%), Query Frame = 0 Query: 58 AKINNKVDLESPKVVTMVEMKPGEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIVSTPK 122 +KIN +DL++ KVV M ++ G+K V+CRCW+SGTFPLCDG H+ HN+ATGDN+GPLIV+ K Sbjct: 42 SKINTLIDLDAEKVVNMEKLDAGKKAVYCRCWKSGTFPLCDGNHVAHNKATGDNVGPLIVTAAK 105
BLAST of NO02G03580 vs. NCBI_GenBank
Match: OLQ06663.1 (2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [Symbiodinium microadriaticum]) HSP 1 Score: 95.9 bits (237), Expect = 9.400e-17 Identity = 40/53 (75.47%), Postives = 46/53 (86.79%), Query Frame = 0 Query: 59 KINNKVDLESPKVVTMVEMKPGEKKVFCRCWQSGTFPLCDGAHMKHNEATGDN 112 KIN K+D ESPKVVT ++K G+K+V+CRCW SGTFPLCDGAH KHNEATGDN Sbjct: 1268 KINGKIDPESPKVVTKEDLKEGDKRVYCRCWLSGTFPLCDGAHAKHNEATGDN 1320
BLAST of NO02G03580 vs. NCBI_GenBank
Match: KHJ89014.1 (zinc finger CDGSH type [Oesophagostomum dentatum]) HSP 1 Score: 95.5 bits (236), Expect = 1.200e-16 Identity = 40/68 (58.82%), Postives = 52/68 (76.47%), Query Frame = 0 Query: 55 LCQAKINNKVDLESPKVVTMVEMKP-GEKKVFCRCWQSGTFPLCDGAHMKHNEATGDNIGPLIVSTPK 122 LC+A++N KV L + KVV V+++ GEKK FCRCW+S FP CDGAH KHN+ TGDN+GPL+V P+ Sbjct: 40 LCKARVNKKVQLANEKVVDTVDVEDIGEKKAFCRCWKSEKFPYCDGAHTKHNKETGDNVGPLLVKVPE 107 The following BLAST results are available for this feature:
BLAST of NO02G03580 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 20
Pagesback to topRelationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO02G03580 ID=NO02G03580|Name=NO02G03580|organism=Nannochloropsis oceanica|type=gene|length=1914bpback to top protein sequence of NO02G03580.2 >NO02G03580.2-protein ID=NO02G03580.2-protein|Name=NO02G03580.2|organism=Nannochloropsis oceanica|type=polypeptide|length=125bpback to top protein sequence of NO02G03580.1 >NO02G03580.1-protein ID=NO02G03580.1-protein|Name=NO02G03580.1|organism=Nannochloropsis oceanica|type=polypeptide|length=130bpback to top Synonyms
Publications
|