NO09G03710, NO09G03710 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO09G03710 vs. NCBI_GenBank
Match: XP_009841720.1 (hypothetical protein H257_15336 [Aphanomyces astaci] >ETV68766.1 hypothetical protein H257_15336 [Aphanomyces astaci]) HSP 1 Score: 71.2 bits (173), Expect = 1.700e-9 Identity = 33/60 (55.00%), Postives = 45/60 (75.00%), Query Frame = 0 Query: 19 MYNRLVERCFKECVTRFRSKKMDDGELSCVSRCAEKYLKLTSRAGFRFAEFQSQQSGAEG 79 +YNR+V CF ECV FRSKK++D E++C++ CAEK+LK T R G RFAE +QQ+ +G Sbjct: 30 LYNRVVATCFNECVQSFRSKKLEDKEVNCMNLCAEKFLKHTQRVGVRFAE--AQQAAMDG 87
BLAST of NO09G03710 vs. NCBI_GenBank
Match: XP_009841721.1 (hypothetical protein, variant [Aphanomyces astaci] >ETV68767.1 hypothetical protein, variant [Aphanomyces astaci]) HSP 1 Score: 71.2 bits (173), Expect = 1.700e-9 Identity = 33/60 (55.00%), Postives = 45/60 (75.00%), Query Frame = 0 Query: 19 MYNRLVERCFKECVTRFRSKKMDDGELSCVSRCAEKYLKLTSRAGFRFAEFQSQQSGAEG 79 +YNR+V CF ECV FRSKK++D E++C++ CAEK+LK T R G RFAE +QQ+ +G Sbjct: 30 LYNRVVATCFNECVQSFRSKKLEDKEVNCMNLCAEKFLKHTQRVGVRFAE--AQQAAMDG 87
BLAST of NO09G03710 vs. NCBI_GenBank
Match: XP_008879473.1 (hypothetical protein H310_13665 [Aphanomyces invadans] >ETV91836.1 hypothetical protein H310_13665 [Aphanomyces invadans]) HSP 1 Score: 69.7 bits (169), Expect = 5.000e-9 Identity = 33/60 (55.00%), Postives = 44/60 (73.33%), Query Frame = 0 Query: 19 MYNRLVERCFKECVTRFRSKKMDDGELSCVSRCAEKYLKLTSRAGFRFAEFQSQQSGAEG 79 +YNR+V CF ECV FRSKK++D E +C++ CAEK+LK T R G RFAE +QQ+ +G Sbjct: 30 LYNRVVATCFNECVQSFRSKKLEDKEENCMNLCAEKFLKHTQRVGVRFAE--AQQAAMDG 87
BLAST of NO09G03710 vs. NCBI_GenBank
Match: XP_010266687.1 (PREDICTED: mitochondrial import inner membrane translocase subunit Tim9 isoform X1 [Nelumbo nucifera]) HSP 1 Score: 69.7 bits (169), Expect = 5.000e-9 Identity = 35/65 (53.85%), Postives = 44/65 (67.69%), Query Frame = 0 Query: 4 ILSPHKHTLTRTHDSMYNRLVERCFKECVTRFRSKKMDDGELSCVSRCAEKYLKLTSRAGFRFAE 69 IL H+ T++ + MYN LVERCF +CV FR K +D E +CV RCAEK+LK + R G RFAE Sbjct: 52 ILQHHQSTVSSSL-RMYNSLVERCFTDCVENFRRKSLDKQEETCVRRCAEKFLKHSMRVGMRFAE 115
BLAST of NO09G03710 vs. NCBI_GenBank
Match: KXZ42650.1 (hypothetical protein GPECTOR_127g528 [Gonium pectorale]) HSP 1 Score: 69.7 bits (169), Expect = 5.000e-9 Identity = 31/54 (57.41%), Postives = 39/54 (72.22%), Query Frame = 0 Query: 19 MYNRLVERCFKECVTRFRSKKMDDGELSCVSRCAEKYLKLTSRAGFRFAEFQSQ 73 MYNRLVERCFKECV RSK + E CV++C EK++ +T+R G RF EF +Q Sbjct: 1 MYNRLVERCFKECVEDMRSKALTGKEEQCVAKCCEKFMHVTARVGMRFQEFFTQ 54
BLAST of NO09G03710 vs. NCBI_GenBank
Match: PHT37644.1 (Mitochondrial import inner membrane translocase subunit Tim9 [Capsicum baccatum]) HSP 1 Score: 69.7 bits (169), Expect = 5.000e-9 Identity = 30/50 (60.00%), Postives = 38/50 (76.00%), Query Frame = 0 Query: 19 MYNRLVERCFKECVTRFRSKKMDDGELSCVSRCAEKYLKLTSRAGFRFAE 69 MYN LVERCF +CV F+ K +D E +CV+RCAEK++KL+ R G RFAE Sbjct: 35 MYNNLVERCFTDCVDNFKRKTLDKQEETCVTRCAEKFMKLSMRVGLRFAE 84
BLAST of NO09G03710 vs. NCBI_GenBank
Match: CAJ73651.1 (translocator of the inner mitochondrial membrane 9 [Guillardia theta]) HSP 1 Score: 69.3 bits (168), Expect = 6.500e-9 Identity = 34/68 (50.00%), Postives = 43/68 (63.24%), Query Frame = 0 Query: 18 SMYNRLVERCFKECVTRFRSKKMDDGELSCVSRCAEKYLKLTSRAGFRFAEFQSQ----QSGAEGGGM 82 +MYN LVERCF CVT FRSK +DD E C++RC K++K ++RAG F Q GA GGG+ Sbjct: 32 TMYNSLVERCFNNCVTSFRSKTLDDREEKCITRCTTKFIKASARAGQAFQAIGMQPGQGMPGAPGGGV 99
BLAST of NO09G03710 vs. NCBI_GenBank
Match: XP_001689615.1 (mitochondrial inner membrane translocase [Chlamydomonas reinhardtii] >PNW88531.1 hypothetical protein CHLRE_01g033400v5 [Chlamydomonas reinhardtii]) HSP 1 Score: 69.3 bits (168), Expect = 6.500e-9 Identity = 31/54 (57.41%), Postives = 39/54 (72.22%), Query Frame = 0 Query: 19 MYNRLVERCFKECVTRFRSKKMDDGELSCVSRCAEKYLKLTSRAGFRFAEFQSQ 73 MYN+LVERCF+ECV RSK + E CVS+C EK++ +T+R G RF EF SQ Sbjct: 34 MYNKLVERCFQECVEDMRSKALTGKEEQCVSKCCEKFMHVTARVGMRFQEFFSQ 87
BLAST of NO09G03710 vs. NCBI_GenBank
Match: XP_009420097.1 (PREDICTED: mitochondrial import inner membrane translocase subunit Tim9-like [Musa acuminata subsp. malaccensis]) HSP 1 Score: 69.3 bits (168), Expect = 6.500e-9 Identity = 32/50 (64.00%), Postives = 36/50 (72.00%), Query Frame = 0 Query: 19 MYNRLVERCFKECVTRFRSKKMDDGELSCVSRCAEKYLKLTSRAGFRFAE 69 MYN LVERCF ECV FR K +D E +CV RCAEK+LK + R G RFAE Sbjct: 35 MYNTLVERCFSECVDTFRRKSLDKQEETCVRRCAEKFLKHSMRVGMRFAE 84
BLAST of NO09G03710 vs. NCBI_GenBank
Match: OMO91250.1 (Tim10/DDP family zinc finger [Corchorus olitorius]) HSP 1 Score: 69.3 bits (168), Expect = 6.500e-9 Identity = 34/63 (53.97%), Postives = 39/63 (61.90%), Query Frame = 0 Query: 10 HTLTRTHDSMYNRLVERCFKECVTRFRSKKMDDGELSCVSRCAEKYLKLTSRAGFRFAEFQSQ 73 H R MYN LVERCF +CV F K + E +CV+RCAEKYLK + R G RFAE SQ Sbjct: 26 HLQLRDSLRMYNSLVERCFTDCVDNFTRKTLQKQEETCVARCAEKYLKHSMRVGLRFAELNSQ 88 The following BLAST results are available for this feature:
BLAST of NO09G03710 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 20
Pagesback to topRelationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO09G03710 ID=NO09G03710|Name=NO09G03710|organism=Nannochloropsis oceanica|type=gene|length=5844bpback to top protein sequence of NO09G03710.1 >NO09G03710.1-protein ID=NO09G03710.1-protein|Name=NO09G03710.1|organism=Nannochloropsis oceanica|type=polypeptide|length=86bpback to top Synonyms
Publications
|