NO08G01350, NO08G01350 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
Homology
BLAST of NO08G01350 vs. NCBI_GenBank
Match: XP_018259750.1 (hypothetical protein I303_07818 [Kwoniella dejecticola CBS 10117] >OBR81908.1 hypothetical protein I303_07818 [Kwoniella dejecticola CBS 10117]) HSP 1 Score: 82.0 bits (201), Expect = 1.700e-12 Identity = 36/73 (49.32%), Postives = 45/73 (61.64%), Query Frame = 0 Query: 74 GGGRWFYFPTHIWTPSGGWFASPKNWKANTLVALGGIGLAALSTFSFSASLERRPIAPAWHIPSQSWCKHAEE 147 GGG + FP +WTPSGGW++ P NW NT + + GIG+A + SAS E+R IAP IPSQ W A E Sbjct: 6 GGGAHYPFPKEVWTPSGGWWSRPSNWATNTAICVFGIGIATFGVWRLSASKEQRHIAPTRAIPSQRWSPQARE 78
BLAST of NO08G01350 vs. NCBI_GenBank
Match: OWZ59727.1 (hypothetical protein C356_00738 [Cryptococcus neoformans var. grubii c45] >OXB39478.1 hypothetical protein J007_00731 [Cryptococcus neoformans var. grubii] >OXC65076.1 hypothetical protein C358_00730 [Cryptococcus neoformans var. grubii MW-RSA852]) HSP 1 Score: 82.0 bits (201), Expect = 1.700e-12 Identity = 35/74 (47.30%), Postives = 46/74 (62.16%), Query Frame = 0 Query: 73 MGGGRWFYFPTHIWTPSGGWFASPKNWKANTLVALGGIGLAALSTFSFSASLERRPIAPAWHIPSQSWCKHAEE 147 MGGG + +P +WTPSGGW+ P NWK+NT + + GI +A + SA+ E R IAP IPSQ W + A E Sbjct: 1 MGGGAQYPYPKEVWTPSGGWWTRPSNWKSNTAICIVGITIATFGVWRLSANREERHIAPTRPIPSQMWSRQARE 74
BLAST of NO08G01350 vs. NCBI_GenBank
Match: XP_012046405.1 (hypothetical protein CNAG_00715 [Cryptococcus neoformans var. grubii H99] >AFR92845.2 hypothetical protein CNAG_00715 [Cryptococcus neoformans var. grubii H99] >OWT37912.1 hypothetical protein C362_04936 [Cryptococcus neoformans var. grubii Bt1] >OWZ36632.1 hypothetical protein C347_00807 [Cryptococcus neoformans var. grubii AD2-60a] >OWZ48302.1 hypothetical protein C343_00731 [Cryptococcus neoformans var. grubii C23] >OWZ56010.1 hypothetical protein C353_00737 [Cryptococcus neoformans var. grubii AD1-83a] >OWZ58071.1 hypothetical protein C368_01244 [Cryptococcus neoformans var. grubii 125.91] >OWZ61263.1 hypothetical protein AYX15_06516 [Cryptococcus neoformans var. grubii] >OWZ70111.1 hypothetical protein AYX14_04513 [Cryptococcus neoformans var. grubii] >OWZ80896.1 hypothetical protein C365_00722 [Cryptococcus neoformans var. grubii Bt85] >OXC68575.1 hypothetical protein AYX13_02779 [Cryptococcus neoformans var. grubii] >OXC86931.1 hypothetical protein C344_00738 [Cryptococcus neoformans var. grubii AD1-7a] >OXG23346.1 hypothetical protein C366_00726 [Cryptococcus neoformans var. grubii Tu401-1] >OXG29076.1 hypothetical protein C361_00731 [Cryptococcus neoformans var. grubii Tu259-1] >OXG34125.1 hypothetical protein C367_00732 [Cryptococcus neoformans var. grubii Ze90-1] >OXG40996.1 hypothetical protein C360_00780 [Cryptococcus neoformans var. grubii Bt15] >OXG45660.1 hypothetical protein C359_00347 [Cryptococcus neoformans var. grubii Bt120] >OXG54328.1 hypothetical protein C355_00727 [Cryptococcus neoformans var. grubii Th84] >OXG68407.1 hypothetical protein C351_00738 [Cryptococcus neoformans var. grubii c8] >OXG68969.1 hypothetical protein C354_00740 [Cryptococcus neoformans var. grubii MW-RSA1955] >OXG72295.1 hypothetical protein C352_00736 [Cryptococcus neoformans var. grubii CHC193] >OXG88351.1 hypothetical protein C350_00725 [Cryptococcus neoformans var. grubii MW-RSA36] >OXG91921.1 hypothetical protein C349_00708 [Cryptococcus neoformans var. grubii Br795] >OXG96077.1 hypothetical protein C346_00729 [Cryptococcus neoformans var. grubii D17-1] >OXG99609.1 hypothetical protein C345_00464 [Cryptococcus neoformans var. grubii A2-102-5] >OXH18328.1 hypothetical protein J010_00706 [Cryptococcus neoformans var. grubii] >OXH18367.1 hypothetical protein C369_00735 [Cryptococcus neoformans var. grubii A5-35-17] >OXH20101.1 hypothetical protein C370_00730 [Cryptococcus neoformans var. grubii A1-35-8] >OXH38065.1 hypothetical protein J009_00728 [Cryptococcus neoformans var. grubii] >OXH39114.1 hypothetical protein J005_00737 [Cryptococcus neoformans var. grubii] >OXH41336.1 hypothetical protein J008_00725 [Cryptococcus neoformans var. grubii] >OXH58742.1 hypothetical protein J003_00731 [Cryptococcus neoformans var. grubii] >OXH59309.1 hypothetical protein J004_00762 [Cryptococcus neoformans var. grubii] >OXH62624.1 hypothetical protein J002_00725 [Cryptococcus neoformans var. grubii] >OXH74869.1 hypothetical protein J000_00727 [Cryptococcus neoformans var. grubii] >OXH75744.1 hypothetical protein J001_00727 [Cryptococcus neoformans var. grubii] >OXL11207.1 hypothetical protein C348_00726 [Cryptococcus neoformans var. grubii Gb118] >OXM81753.1 hypothetical protein C364_00725 [Cryptococcus neoformans var. grubii Bt63] >AUB22323.1 ARF guanyl-nucleotide exchange factor [Cryptococcus neoformans var. grubii]) HSP 1 Score: 81.6 bits (200), Expect = 2.200e-12 Identity = 35/74 (47.30%), Postives = 45/74 (60.81%), Query Frame = 0 Query: 73 MGGGRWFYFPTHIWTPSGGWFASPKNWKANTLVALGGIGLAALSTFSFSASLERRPIAPAWHIPSQSWCKHAEE 147 MGGG + +P +WTPSGGW+ P NWK NT + + GI +A + SA+ E R IAP IPSQ W + A E Sbjct: 1 MGGGAQYPYPKEVWTPSGGWWTRPSNWKGNTAICIVGITIATFGVWRLSANREERHIAPTRPIPSQMWSRQARE 74
BLAST of NO08G01350 vs. NCBI_GenBank
Match: KGB75375.1 (hypothetical protein CNBG_1213 [Cryptococcus gattii VGII R265] >KIR30791.1 hypothetical protein I309_00142 [Cryptococcus gattii VGII LA55] >KIR35742.1 hypothetical protein I352_02020 [Cryptococcus gattii VGII MMRL2647] >KIR72702.1 hypothetical protein I310_03303 [Cryptococcus gattii VGII CA1014] >KIR95117.1 hypothetical protein I304_01444 [Cryptococcus gattii VGII CBS 10090] >KIS00361.1 hypothetical protein L804_01773 [Cryptococcus gattii VGII 2001/935-1]) HSP 1 Score: 81.3 bits (199), Expect = 2.900e-12 Identity = 34/74 (45.95%), Postives = 45/74 (60.81%), Query Frame = 0 Query: 73 MGGGRWFYFPTHIWTPSGGWFASPKNWKANTLVALGGIGLAALSTFSFSASLERRPIAPAWHIPSQSWCKHAEE 147 MGGG + +P +WTPSGGW++ P NWK NT + + GI +A + SA+ E R AP IPSQ W + A E Sbjct: 1 MGGGAQYPYPKEVWTPSGGWWSRPSNWKGNTAICIAGITIATFGVWRLSANREERHAAPTRPIPSQMWSRQARE 74
BLAST of NO08G01350 vs. NCBI_GenBank
Match: PAV18230.1 (hypothetical protein PNOK_0671600 [Phellinus noxius]) HSP 1 Score: 81.3 bits (199), Expect = 2.900e-12 Identity = 36/73 (49.32%), Postives = 47/73 (64.38%), Query Frame = 0 Query: 73 MGGGRWFYFPTHIWTPSGGWFASPKNWKANTLVALGGIGLAALSTFSFSASLERRPIAPAWHIPSQSWCKHAE 146 MGGG + +P +W+P+GGW+ P NWK+NT VA GGI L +T+ SAS E R +AP+ IPS W K E Sbjct: 1 MGGGGQYPYPKEVWSPAGGWWTRPSNWKSNTAVAFGGILLTVYATWQLSASKEVRHVAPSKPIPSMLWAKQYE 73
BLAST of NO08G01350 vs. NCBI_GenBank
Match: XP_002504370.1 (hypothetical protein MICPUN_113359 [Micromonas commoda] >ACO65628.1 hypothetical protein MICPUN_113359 [Micromonas commoda]) HSP 1 Score: 80.1 bits (196), Expect = 6.500e-12 Identity = 31/62 (50.00%), Postives = 45/62 (72.58%), Query Frame = 0 Query: 85 IWTPSGGWFASPKNWKANTLVALGGIGLAALSTFSFSASLERRPIAPAWHIPSQSWCKHAEE 147 +W+P+GGWFA PK+WK NT + G + +A+ F++S LE+RP+AP IPSQ+WCK+ E Sbjct: 12 VWSPAGGWFADPKHWKRNTAMGFGVLAVASAMIFNYSRKLEQRPLAPTRRIPSQAWCKNFPE 73
BLAST of NO08G01350 vs. NCBI_GenBank
Match: XP_024511993.1 (hypothetical protein CNA06940 [Cryptococcus neoformans var. neoformans JEC21] >AAW41192.2 hypothetical protein CNA06940 [Cryptococcus neoformans var. neoformans JEC21]) HSP 1 Score: 80.1 bits (196), Expect = 6.500e-12 Identity = 34/74 (45.95%), Postives = 45/74 (60.81%), Query Frame = 0 Query: 73 MGGGRWFYFPTHIWTPSGGWFASPKNWKANTLVALGGIGLAALSTFSFSASLERRPIAPAWHIPSQSWCKHAEE 147 MGGG + +P +WTPSGGW++ P NWK NT + + GI +A + SA+ E R AP IPSQ W + A E Sbjct: 1 MGGGAQYPYPKEVWTPSGGWWSRPSNWKGNTAICIVGITIATFGVWRLSANREERHTAPTRPIPSQMWSRQARE 74
BLAST of NO08G01350 vs. NCBI_GenBank
Match: KIR42473.1 (hypothetical protein I313_01698 [Cryptococcus gattii VGII Ram5] >KIY59877.1 hypothetical protein I307_00952 [Cryptococcus gattii VGII 99/473]) HSP 1 Score: 79.7 bits (195), Expect = 8.500e-12 Identity = 33/74 (44.59%), Postives = 44/74 (59.46%), Query Frame = 0 Query: 73 MGGGRWFYFPTHIWTPSGGWFASPKNWKANTLVALGGIGLAALSTFSFSASLERRPIAPAWHIPSQSWCKHAEE 147 MGGG + +P +WTPSGGW++ P NWK NT + + GI +A + SA+ E R AP IPSQ W + E Sbjct: 1 MGGGAQYPYPKEVWTPSGGWWSRPSNWKGNTAICIAGITIATFGVWRLSANREERHAAPTRPIPSQMWSRQTRE 74
BLAST of NO08G01350 vs. NCBI_GenBank
Match: XP_007379548.1 (hypothetical protein PUNSTDRAFT_81119 [Punctularia strigosozonata HHB-11173 SS5] >EIN14631.1 hypothetical protein PUNSTDRAFT_81119 [Punctularia strigosozonata HHB-11173 SS5]) HSP 1 Score: 79.7 bits (195), Expect = 8.500e-12 Identity = 32/74 (43.24%), Postives = 47/74 (63.51%), Query Frame = 0 Query: 73 MGGGRWFYFPTHIWTPSGGWFASPKNWKANTLVALGGIGLAALSTFSFSASLERRPIAPAWHIPSQSWCKHAEE 147 MGGG + +P H+W+P+GGW+A P NWK NT + GGI L+T++ S E R + P+ IPS +W K ++ Sbjct: 1 MGGGARYPYPKHVWSPAGGWWARPSNWKTNTAITAGGIAAIVLATWNISKDKEWRDVEPSKPIPSMNWTKQYKD 74
BLAST of NO08G01350 vs. NCBI_GenBank
Match: XP_003064826.1 (predicted protein [Micromonas pusilla CCMP1545] >EEH51160.1 predicted protein [Micromonas pusilla CCMP1545]) HSP 1 Score: 79.3 bits (194), Expect = 1.100e-11 Identity = 31/65 (47.69%), Postives = 45/65 (69.23%), Query Frame = 0 Query: 83 THIWTPSGGWFASPKNWKANTLVALGGIGLAALSTFSFSASLERRPIAPAWHIPSQSWCKHAEED 148 + +W+P+GGWFA PK WK NT + G AA++ FS+S +E+RP++P IPSQ+WC + ED Sbjct: 15 SRVWSPAGGWFADPKAWKRNTAIGFLAAGAAAVAIFSYSRKVEQRPLSPTRRIPSQAWCDNFPED 79 The following BLAST results are available for this feature:
BLAST of NO08G01350 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 20
Pagesback to topRelationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO08G01350 ID=NO08G01350|Name=NO08G01350|organism=Nannochloropsis oceanica|type=gene|length=1301bpback to top protein sequence of NO08G01350.1 >NO08G01350.1-protein ID=NO08G01350.1-protein|Name=NO08G01350.1|organism=Nannochloropsis oceanica|type=polypeptide|length=152bpback to top Synonyms
Publications
|