NO01G03740, NO01G03740 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO01G03740 vs. NCBI_GenBank
Match: XP_020960804.1 (E3 ubiquitin-protein ligase At1g12760 isoform X2 [Arachis ipaensis]) HSP 1 Score: 77.8 bits (190), Expect = 1.400e-10 Identity = 29/57 (50.88%), Postives = 38/57 (66.67%), Query Frame = 0 Query: 429 CCICLSDFERTDLVRKLPCGHLFHSECVDSWFSFNSVCPLCKANVLDKLNQYPLPEG 486 CCICL+ +E D +R+LPC HLFH +CVD W N++CPLCK+ V + L EG Sbjct: 335 CCICLAKYENNDELRELPCSHLFHKDCVDKWLKINALCPLCKSEVGENLTGSGAAEG 391
BLAST of NO01G03740 vs. NCBI_GenBank
Match: XP_021686831.1 (E3 ubiquitin-protein ligase At1g63170-like [Hevea brasiliensis]) HSP 1 Score: 77.4 bits (189), Expect = 1.800e-10 Identity = 30/52 (57.69%), Postives = 36/52 (69.23%), Query Frame = 0 Query: 428 ECCICLSDFERTDLVRKLPCGHLFHSECVDSWFSFNSVCPLCKANVLDKLNQ 480 ECCICLS +E +RKLPC H FHS C+D W N++CPLCK N+L NQ Sbjct: 326 ECCICLSAYEDGTELRKLPCHHHFHSTCIDKWLYINAICPLCKFNILKASNQ 377
BLAST of NO01G03740 vs. NCBI_GenBank
Match: XP_017231465.1 (PREDICTED: E3 ubiquitin-protein ligase At1g63170 [Daucus carota subsp. sativus] >KZN08844.1 hypothetical protein DCAR_001500 [Daucus carota subsp. sativus]) HSP 1 Score: 77.0 bits (188), Expect = 2.400e-10 Identity = 28/49 (57.14%), Postives = 34/49 (69.39%), Query Frame = 0 Query: 429 CCICLSDFERTDLVRKLPCGHLFHSECVDSWFSFNSVCPLCKANVLDKL 478 CCICLS + D +R+LPC H FH ECVD W N++CPLCK V DK+ Sbjct: 349 CCICLSKYANNDELRELPCSHFFHKECVDKWLKINALCPLCKGEVGDKI 397
BLAST of NO01G03740 vs. NCBI_GenBank
Match: OIW14377.1 (hypothetical protein TanjilG_15731 [Lupinus angustifolius]) HSP 1 Score: 77.0 bits (188), Expect = 2.400e-10 Identity = 27/51 (52.94%), Postives = 37/51 (72.55%), Query Frame = 0 Query: 429 CCICLSDFERTDLVRKLPCGHLFHSECVDSWFSFNSVCPLCKANVLDKLNQ 480 CCICL+ +E D +R+LPC H+FH ECVD W N++CPLCK+ V + L + Sbjct: 139 CCICLAKYENNDELRELPCSHIFHKECVDKWLKINALCPLCKSEVGENLTR 189
BLAST of NO01G03740 vs. NCBI_GenBank
Match: XP_019438792.1 (PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X1 [Lupinus angustifolius]) HSP 1 Score: 77.0 bits (188), Expect = 2.400e-10 Identity = 27/51 (52.94%), Postives = 37/51 (72.55%), Query Frame = 0 Query: 429 CCICLSDFERTDLVRKLPCGHLFHSECVDSWFSFNSVCPLCKANVLDKLNQ 480 CCICL+ +E D +R+LPC H+FH ECVD W N++CPLCK+ V + L + Sbjct: 359 CCICLAKYENNDELRELPCSHIFHKECVDKWLKINALCPLCKSEVGENLTR 409
BLAST of NO01G03740 vs. NCBI_GenBank
Match: XP_019438793.1 (PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X2 [Lupinus angustifolius] >XP_019438794.1 PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X2 [Lupinus angustifolius]) HSP 1 Score: 77.0 bits (188), Expect = 2.400e-10 Identity = 27/51 (52.94%), Postives = 37/51 (72.55%), Query Frame = 0 Query: 429 CCICLSDFERTDLVRKLPCGHLFHSECVDSWFSFNSVCPLCKANVLDKLNQ 480 CCICL+ +E D +R+LPC H+FH ECVD W N++CPLCK+ V + L + Sbjct: 339 CCICLAKYENNDELRELPCSHIFHKECVDKWLKINALCPLCKSEVGENLTR 389
BLAST of NO01G03740 vs. NCBI_GenBank
Match: XP_003545507.2 (PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X1 [Glycine max]) HSP 1 Score: 76.6 bits (187), Expect = 3.100e-10 Identity = 27/49 (55.10%), Postives = 37/49 (75.51%), Query Frame = 0 Query: 429 CCICLSDFERTDLVRKLPCGHLFHSECVDSWFSFNSVCPLCKANVLDKL 478 CCICL+ +E D +R+LPC HLFH +CVD W N++CPLCK++V + L Sbjct: 361 CCICLAKYENNDELRELPCSHLFHKDCVDKWLKINALCPLCKSDVGENL 409
BLAST of NO01G03740 vs. NCBI_GenBank
Match: XP_006596122.1 (PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X2 [Glycine max] >KRH16047.1 hypothetical protein GLYMA_14G129100 [Glycine max] >KRH16048.1 hypothetical protein GLYMA_14G129100 [Glycine max]) HSP 1 Score: 76.6 bits (187), Expect = 3.100e-10 Identity = 27/49 (55.10%), Postives = 37/49 (75.51%), Query Frame = 0 Query: 429 CCICLSDFERTDLVRKLPCGHLFHSECVDSWFSFNSVCPLCKANVLDKL 478 CCICL+ +E D +R+LPC HLFH +CVD W N++CPLCK++V + L Sbjct: 343 CCICLAKYENNDELRELPCSHLFHKDCVDKWLKINALCPLCKSDVGENL 391
BLAST of NO01G03740 vs. NCBI_GenBank
Match: XP_003549235.2 (PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X1 [Glycine max] >KRH05037.1 hypothetical protein GLYMA_17G203800 [Glycine max]) HSP 1 Score: 76.6 bits (187), Expect = 3.100e-10 Identity = 27/49 (55.10%), Postives = 37/49 (75.51%), Query Frame = 0 Query: 429 CCICLSDFERTDLVRKLPCGHLFHSECVDSWFSFNSVCPLCKANVLDKL 478 CCICL+ +E D +R+LPC HLFH +CVD W N++CPLCK++V + L Sbjct: 375 CCICLAKYENNDELRELPCSHLFHKDCVDKWLKINALCPLCKSDVGENL 423
BLAST of NO01G03740 vs. NCBI_GenBank
Match: XP_006601116.1 (PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X2 [Glycine max] >XP_006601117.1 PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X2 [Glycine max] >XP_006601118.1 PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X2 [Glycine max] >XP_014625486.1 PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X2 [Glycine max] >XP_014625487.1 PREDICTED: E3 ubiquitin-protein ligase At1g63170-like isoform X2 [Glycine max] >KRH05038.1 hypothetical protein GLYMA_17G203800 [Glycine max] >KRH05039.1 hypothetical protein GLYMA_17G203800 [Glycine max] >KRH05040.1 hypothetical protein GLYMA_17G203800 [Glycine max] >KRH05041.1 hypothetical protein GLYMA_17G203800 [Glycine max]) HSP 1 Score: 76.6 bits (187), Expect = 3.100e-10 Identity = 27/49 (55.10%), Postives = 37/49 (75.51%), Query Frame = 0 Query: 429 CCICLSDFERTDLVRKLPCGHLFHSECVDSWFSFNSVCPLCKANVLDKL 478 CCICL+ +E D +R+LPC HLFH +CVD W N++CPLCK++V + L Sbjct: 344 CCICLAKYENNDELRELPCSHLFHKDCVDKWLKINALCPLCKSDVGENL 392 The following BLAST results are available for this feature:
BLAST of NO01G03740 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 20
Pagesback to topRelationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO01G03740 ID=NO01G03740|Name=NO01G03740|organism=Nannochloropsis oceanica|type=gene|length=4871bpback to top protein sequence of NO01G03740.1 >NO01G03740.1-protein ID=NO01G03740.1-protein|Name=NO01G03740.1|organism=Nannochloropsis oceanica|type=polypeptide|length=662bpback to top protein sequence of NO01G03740.2 >NO01G03740.2-protein ID=NO01G03740.2-protein|Name=NO01G03740.2|organism=Nannochloropsis oceanica|type=polypeptide|length=423bpback to top Synonyms
Publications
|