NO15G00890, NO15G00890 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO15G00890 vs. NCBI_GenBank
Match: XP_005852783.1 (ribosomal rna large subunit methyltransferase h [Nannochloropsis gaditana CCMP526] >EKU23052.1 ribosomal rna large subunit methyltransferase h [Nannochloropsis gaditana CCMP526] >EWM22458.1 ribosomal rna large subunit methyltransferase h [Nannochloropsis gaditana]) HSP 1 Score: 165.2 bits (417), Expect = 2.100e-37 Identity = 91/145 (62.76%), Postives = 105/145 (72.41%), Query Frame = 0 Query: 65 VRPWRALPLLIFRLVLLSTLQPTMSFIAFQTQRLASTLRICSTTATTTIYPTRAFRATPTCGLQINIHIRGKRTGGEEYLNDAYLEYTKRLRPVLELETIWHKTDEELKAAVAKEKAPVICLDERGKQLPSLELADVLYKRLEEG 210 +R W A +L F L+ +Q M F AF S R C + + T AFR TP CGLQ+ IHIRGKR+GGEE+LNDAYLEYTKRLRPVL L T+WHKTD EL+AA+AKEKAPVICLDE GKQL S+ELAD+LYKRLEEG Sbjct: 21 IRFWTAFSVLFF----LNFVQSNM-FFAF------SHTRYCRRLVRSPTF-THAFRVTPACGLQVTIHIRGKRSGGEEFLNDAYLEYTKRLRPVLGLTTVWHKTDSELEAAIAKEKAPVICLDEGGKQLSSMELADILYKRLEEG 153
BLAST of NO15G00890 vs. NCBI_GenBank
Match: CBJ28859.1 (conserved unknown protein [Ectocarpus siliculosus]) HSP 1 Score: 79.7 bits (195), Expect = 1.200e-11 Identity = 37/63 (58.73%), Postives = 48/63 (76.19%), Query Frame = 0 Query: 147 AYLEYTKRLRPVLELETIWHKTDEELKAAVAKEKAPVICLDERGKQLPSLELADVLYKRLEEG 210 AY EY KRLRPVL L+T WHKTD++L+AAV K+ V+CLDE G+Q+ S +D L+ +LEEG Sbjct: 63 AYDEYAKRLRPVLALDTQWHKTDDDLEAAVRKDPGVVVCLDEGGRQMNSPAFSDFLFSKLEEG 125
BLAST of NO15G00890 vs. NCBI_GenBank
Match: OLP85879.1 (Ribosomal RNA large subunit methyltransferase H [Symbiodinium microadriaticum]) HSP 1 Score: 66.6 bits (161), Expect = 1.000e-7 Identity = 37/85 (43.53%), Postives = 53/85 (62.35%), Query Frame = 0 Query: 128 QINIHIRGKRTGGEEYLNDAYLEYTKRLR---PVLELETIWHKTDEELKAAVAKEKAPVICLDERGKQLPSLELADVLYKRLEEG 210 ++ +H+ GK G + A EY +RLR P +E+ETI+HK D +L A+ K + P++ LDERG L S E A +L+ RLEEG Sbjct: 997 KVTVHVVGKPVSG-GWEGTAVEEYVQRLRGRDPAIEVETIFHKADAQLLRALKKLRHPILVLDERGALLDSEEFARLLFARLEEG 1080
BLAST of NO15G00890 vs. NCBI_GenBank
Match: XP_002179243.1 (predicted protein [Phaeodactylum tricornutum CCAP 1055/1] >EEC49066.1 predicted protein [Phaeodactylum tricornutum CCAP 1055/1]) HSP 1 Score: 65.1 bits (157), Expect = 3.000e-7 Identity = 37/97 (38.14%), Postives = 54/97 (55.67%), Query Frame = 0 Query: 118 AFRATPTC-GLQINIHIRGKRTGGEEYLNDAYLEYTKRLRPV-LELETIWHKTDEELKAAVAKE---KAPVICLDERGKQLPSLELADVLYKRLEEG 210 A +T C GL+ I I G+++G E +L DA Y RL+P ++++T WHK D+ L V + PV+ LD RGK+ S + D YK +E G Sbjct: 36 ASSSTTRCMGLKTTIRIVGRKSGSESWLEDACSMYETRLKPANIDVQTEWHKNDQSLTKGVQSDYVRNVPVVMLDPRGKRFTSEQFTDDFYKWMEIG 132 The following BLAST results are available for this feature:
BLAST of NO15G00890 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 4
Relationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO15G00890 ID=NO15G00890|Name=NO15G00890|organism=Nannochloropsis oceanica|type=gene|length=2995bpback to top protein sequence of NO15G00890.1 >NO15G00890.1-protein ID=NO15G00890.1-protein|Name=NO15G00890.1|organism=Nannochloropsis oceanica|type=polypeptide|length=222bpback to top protein sequence of NO15G00890.2 >NO15G00890.2-protein ID=NO15G00890.2-protein|Name=NO15G00890.2|organism=Nannochloropsis oceanica|type=polypeptide|length=269bpback to top protein sequence of NO15G00890.3 >NO15G00890.3-protein ID=NO15G00890.3-protein|Name=NO15G00890.3|organism=Nannochloropsis oceanica|type=polypeptide|length=211bpback to top Synonyms
Publications
|