NO11G00250, NO11G00250 (gene) Nannochloropsis oceanica

Overview
NameNO11G00250
Unique NameNO11G00250
Typegene
OrganismNannochloropsis oceanica (N. oceanica IMET1)
Sequence length952
Alignment locationchr11:104601..105552 +

Link to JBrowse

Properties
Property NameValue
DescriptionHistone h3
Mutants
Expression

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr11genomechr11:104601..105552 +
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
GSE1786722023-12-15
PRJNA9336932023-10-26
PRJNA9434492023-07-19
GSE1499042020-10-10
NoIMET1_WT_HS2020-09-29
GSE1396152020-03-11
PRJNA2413822020-03-11
BLASTP analysis of N. oceanica IMET1 genes2019-07-11
InterPro analysis for N. oceanica IMET1 genes2019-07-11
GO annotation for IMET1v2 genes2019-07-10
PRJNA1821802019-04-25
Gene prediction for N. oceanica IMET12017-10-24
Annotated Terms
The following terms have been associated with this gene:
Vocabulary: Molecular Function
TermDefinition
GO:0046982protein heterodimerization activity
GO:0003677DNA binding
GO:0005515protein binding
GO:0003677DNA binding
Vocabulary: Cellular Component
TermDefinition
GO:0000786nucleosome
GO:0005634nucleus
Vocabulary: INTERPRO
TermDefinition
IPR009072Histone-fold
IPR007125Histone_core_D
IPR000164Histone_H3/CENP-A
Homology
[Close]
BLAST of NO11G00250 vs. NCBI_GenBank
Match: XP_005855528.1 (histone H3 [Nannochloropsis gaditana CCMP526] >EKU20822.1 histone H3 [Nannochloropsis gaditana CCMP526])

HSP 1 Score: 253.1 bits (645), Expect = 5.100e-64
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDVQLARRIRGERA 137
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEA EAYLVGLFEDTNLCAIHAKRVTIMPKDVQLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEATEAYLVGLFEDTNLCAIHAKRVTIMPKDVQLARRIRGERA 136
[Close]
BLAST of NO11G00250 vs. NCBI_GenBank
Match: EWM25200.1 (histone h3 [Nannochloropsis gaditana])

HSP 1 Score: 253.1 bits (645), Expect = 5.100e-64
Identity = 135/136 (99.26%), Postives = 135/136 (99.26%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDVQLARRIRGERA 137
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEA EAYLVGLFEDTNLCAIHAKRVTIMPKDVQLARRIRGERA
Sbjct:   90 MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEATEAYLVGLFEDTNLCAIHAKRVTIMPKDVQLARRIRGERA 225
[Close]
BLAST of NO11G00250 vs. NCBI_GenBank
Match: CBN79887.1 (conserved unknown protein [Ectocarpus siliculosus])

HSP 1 Score: 251.9 bits (642), Expect = 1.100e-63
Identity = 133/136 (97.79%), Postives = 135/136 (99.26%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDVQLARRIRGERA 137
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEA EAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
[Close]
BLAST of NO11G00250 vs. NCBI_GenBank
Match: XP_001419259.1 (predicted protein [Ostreococcus lucimarinus CCE9901] >XP_022840891.1 Histone core [Ostreococcus tauri] >ABO97552.1 predicted protein [Ostreococcus lucimarinus CCE9901] >CEG01325.1 Histone core [Ostreococcus tauri])

HSP 1 Score: 250.8 bits (639), Expect = 2.500e-63
Identity = 132/136 (97.06%), Postives = 134/136 (98.53%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDVQLARRIRGERA 137
            MARTKQTARKSTGGKAPRKQLATKAARKSAPT GGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTA+LALQEA EAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAVLALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
[Close]
BLAST of NO11G00250 vs. NCBI_GenBank
Match: GAX93015.1 (histone H3 [Pythium insidiosum])

HSP 1 Score: 250.0 bits (637), Expect = 4.300e-63
Identity = 132/135 (97.78%), Postives = 134/135 (99.26%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDVQLARRIRGER 136
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQD+KTDLRFQSTAILALQEA EAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIRGER
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDYKTDLRFQSTAILALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 135
[Close]
BLAST of NO11G00250 vs. NCBI_GenBank
Match: XP_005843780.1 (hypothetical protein CHLNCDRAFT_59160 [Chlorella variabilis] >EFN51678.1 hypothetical protein CHLNCDRAFT_59160 [Chlorella variabilis] >PRW59210.1 Histone [Chlorella sorokiniana])

HSP 1 Score: 249.6 bits (636), Expect = 5.600e-63
Identity = 131/136 (96.32%), Postives = 134/136 (98.53%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDVQLARRIRGERA 137
            MARTKQTARKSTGGKAPRKQLATKAARKSAPT GGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A+LALQEA EAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTTGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVLALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
[Close]
BLAST of NO11G00250 vs. NCBI_GenBank
Match: 3AFA_A (Chain A, The Human Nucleosome Structure >3AFA_E Chain E, The Human Nucleosome Structure >3AZI_A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H4k31q Mutation >3AZI_E Chain E, Crystal Structure Of Human Nucleosome Core Particle Containing H4k31q Mutation >3AZJ_A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H4k44q Mutation >3AZJ_E Chain E, Crystal Structure Of Human Nucleosome Core Particle Containing H4k44q Mutation >3AZK_A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H4k59q Mutation >3AZK_E Chain E, Crystal Structure Of Human Nucleosome Core Particle Containing H4k59q Mutation >3AZL_A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H4k77q Mutation >3AZL_E Chain E, Crystal Structure Of Human Nucleosome Core Particle Containing H4k77q Mutation >3AZM_A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H4k79q Mutation >3AZM_E Chain E, Crystal Structure Of Human Nucleosome Core Particle Containing H4k79q Mutation >3AZN_A Chain A, Crystal Structure Of Human Nucleosome Core Particle Containing H4k91q Mutation >3AZN_E Chain E, Crystal Structure Of Human Nucleosome Core Particle Containing H4k91q Mutation >3W96_A Chain A, Crystal Structure Of Human Nucleosome Core Particle Lacking H2a N- Terminal Region >3W96_E Chain E, Crystal Structure Of Human Nucleosome Core Particle Lacking H2a N- Terminal Region >3W97_A Chain A, Crystal Structure Of Human Nucleosome Core Particle Lacking H2b N- Terminal Region >3W97_E Chain E, Crystal Structure Of Human Nucleosome Core Particle Lacking H2b N- Terminal Region >3W99_A Chain A, Crystal Structure Of Human Nucleosome Core Particle Lacking H4 N- Terminal Region >3W99_E Chain E, Crystal Structure Of Human Nucleosome Core Particle Lacking H4 N- Terminal Region >3WA9_A Chain A, The Nucleosome Containing Human H2a.z.1 >3WA9_E Chain E, The Nucleosome Containing Human H2a.z.1 >3WAA_A Chain A, The Nucleosome Containing Human H2a.z.2 >3WAA_E Chain E, The Nucleosome Containing Human H2a.z.2 >3WKJ_A Chain A, The Nucleosome Containing Human Tsh2b >3WKJ_E Chain E, The Nucleosome Containing Human Tsh2b >5CPI_A Chain A, Nucleosome Containing Unmethylated Sat2r Dna >5CPI_E Chain E, Nucleosome Containing Unmethylated Sat2r Dna >5CPJ_A Chain A, Nucleosome Containing Methylated Sat2r Dna >5CPJ_E Chain E, Nucleosome Containing Methylated Sat2r Dna >5CPK_A Chain A, Nucleosome Containing Methylated Sat2l Dna >5CPK_E Chain E, Nucleosome Containing Methylated Sat2l Dna >4YM5_A Chain A, Crystal Structure Of The Human Nucleosome Containing 6-4pp (inside) >4YM5_E Chain E, Crystal Structure Of The Human Nucleosome Containing 6-4pp (inside) >4YM6_A Chain A, Crystal Structure Of The Human Nucleosome Containing 6-4pp (outside) >4YM6_E Chain E, Crystal Structure Of The Human Nucleosome Containing 6-4pp (outside) >5AV5_A Chain A, Human Nucleosome Core Particle >5AV5_E Chain E, Human Nucleosome Core Particle >5AV6_A Chain A, Human Nucleosome Core Particle >5AV6_E Chain E, Human Nucleosome Core Particle >5AV8_A Chain A, Human Nucleosome Core Particle >5AV8_E Chain E, Human Nucleosome Core Particle >5AV9_A Chain A, Human Nucleosome Core Particle >5AV9_E Chain E, Human Nucleosome Core Particle >5AVB_A Chain A, Human Nucleosome Core Particle >5AVB_E Chain E, Human Nucleosome Core Particle >5AVC_A Chain A, Human Nucleosome Core Particle >5AVC_E Chain E, Human Nucleosome Core Particle >5B24_A Chain A, The Crystal Structure Of The Nucleosome Containing Cyclobutane Pyrimidine Dimer >5B24_E Chain E, The Crystal Structure Of The Nucleosome Containing Cyclobutane Pyrimidine Dimer >5B2I_A Chain A, Human Nucleosome Containing Cpg Unmethylated Dna >5B2I_E Chain E, Human Nucleosome Containing Cpg Unmethylated Dna >5B2J_A Chain A, Human Nucleosome Containing Cpg Methylated Dna >5B2J_E Chain E, Human Nucleosome Containing Cpg Methylated Dna >5B31_A Chain A, The Crystal Structure Of The Heterotypic H2az/h2a Nucleosome With H3.1. >5B31_E Chain E, The Crystal Structure Of The Heterotypic H2az/h2a Nucleosome With H3.1. >5B1M_A Chain A, The Mouse Nucleosome Structure Containing H3.1 >5B1M_E Chain E, The Mouse Nucleosome Structure Containing H3.1 >5JRG_A Chain A, Crystal Structure Of The Nucleosome Containing The Dna With Tetrahydrofuran (thf) >5JRG_E Chain E, Crystal Structure Of The Nucleosome Containing The Dna With Tetrahydrofuran (thf) >5GSE_A Chain A, Crystal Structure Of Unusual Nucleosome >5GSE_E Chain E, Crystal Structure Of Unusual Nucleosome >5GSE_K Chain K, Crystal Structure Of Unusual Nucleosome >5GSE_O Chain O, Crystal Structure Of Unusual Nucleosome >5GTC_A Chain A, Crystal Structure Of Complex Between Dmap-sh Conjugated With A Kaposi's Sarcoma Herpesvirus Lana Peptide (5-15) And Nucleosome Core Particle >5GTC_E Chain E, Crystal Structure Of Complex Between Dmap-sh Conjugated With A Kaposi's Sarcoma Herpesvirus Lana Peptide (5-15) And Nucleosome Core Particle)

HSP 1 Score: 249.2 bits (635), Expect = 7.300e-63
Identity = 129/136 (94.85%), Postives = 134/136 (98.53%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDVQLARRIRGERA 137
            MARTKQTARKSTGGKAPRKQLATKAARKSAP  GGVKKPHRYRPGTVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A++ALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIRGERA
Sbjct:    4 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 139
[Close]
BLAST of NO11G00250 vs. NCBI_GenBank
Match: CCA22507.1 (histone H3.3 type 1 putative [Albugo laibachii Nc14] >CCI43833.1 unnamed protein product [Albugo candida])

HSP 1 Score: 249.2 bits (635), Expect = 7.300e-63
Identity = 131/135 (97.04%), Postives = 134/135 (99.26%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDVQLARRIRGER 136
            MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKST+LLIRKLPFQRLVREIAQD+KTDLRFQSTAILALQEA EAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIRGER
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTDLLIRKLPFQRLVREIAQDYKTDLRFQSTAILALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGER 135
[Close]
BLAST of NO11G00250 vs. NCBI_GenBank
Match: XP_527253.2 (histone H3.1-like [Pan troglodytes] >XP_008959258.1 PREDICTED: histone H3.1-like [Pan paniscus])

HSP 1 Score: 249.2 bits (635), Expect = 7.300e-63
Identity = 129/136 (94.85%), Postives = 134/136 (98.53%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDVQLARRIRGERA 137
            MARTKQTARKSTGGKAPRKQLATKAARKSAP  GGVKKPHRYRPGTVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A++ALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIRGERA
Sbjct:   18 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 153
[Close]
BLAST of NO11G00250 vs. NCBI_GenBank
Match: NP_003520.1 (histone H3.1 [Homo sapiens] >NP_003522.1 histone H3.1 [Homo sapiens] >NP_003523.1 histone H3.1 [Homo sapiens] >NP_003524.1 histone H3.1 [Homo sapiens] >NP_003525.1 histone H3.1 [Homo sapiens] >NP_003526.1 histone H3.1 [Homo sapiens] >NP_003527.1 histone H3.1 [Homo sapiens] >NP_003528.1 histone H3.1 [Homo sapiens] >NP_066298.1 histone H3.1 [Homo sapiens] >NP_003521.2 histone H3.1 [Homo sapiens] >NP_659539.1 histone H3.1 [Mus musculus] >NP_835513.1 histone H3.1 [Mus musculus] >NP_835514.1 histone H3.1 [Mus musculus] >NP_038578.2 histone H3.1 [Mus musculus] >NP_001013074.1 histone H3.1 [Rattus norvegicus] >NP_001180643.1 histone H3.1 [Macaca mulatta] >NP_001274345.1 histone H3.1 [Sus scrofa] >XP_874006.1 PREDICTED: histone H3.1 [Bos taurus] >XP_001083954.1 PREDICTED: histone H3.1 [Macaca mulatta] >XP_001087706.1 PREDICTED: histone H3.1 [Macaca mulatta] >XP_527254.2 histone H3.1 [Pan troglodytes] >XP_002746186.1 PREDICTED: histone H3.1 [Callithrix jacchus] >XP_002697506.1 PREDICTED: histone H3.1 [Bos taurus] >XP_002697575.1 PREDICTED: histone H3.1 [Bos taurus] >XP_002816565.1 histone H3.1 [Pongo abelii] >XP_002816571.1 histone H3.1 isoform X2 [Pongo abelii] >XP_002928575.1 PREDICTED: histone H3.1 [Ailuropoda melanoleuca] >XP_003263321.1 PREDICTED: histone H3.1 isoform X2 [Nomascus leucogenys] >XP_003263325.1 PREDICTED: histone H3.1 [Nomascus leucogenys] >XP_003272012.1 PREDICTED: histone H3.1 isoform X2 [Nomascus leucogenys] >XP_003468857.1 histone H3.1 [Cavia porcellus] >XP_003788843.1 histone H3.1 [Otolemur garnettii] >XP_003804475.1 PREDICTED: histone H3.1 [Pan paniscus] >XP_003804597.1 PREDICTED: histone H3.1 [Pan paniscus] >XP_003829731.1 PREDICTED: histone H3.1 [Pan paniscus] >XP_003897202.1 histone H3.1 [Papio anubis] >XP_003897273.1 histone H3.1 [Papio anubis] >XP_003927331.1 PREDICTED: histone H3.1 [Saimiri boliviensis boliviensis] >XP_003985741.1 histone H3.1 [Felis catus] >XP_003985773.1 histone H3.1 [Felis catus] >XP_004043431.1 PREDICTED: histone H3.1 [Gorilla gorilla gorilla] >XP_004043511.1 PREDICTED: histone H3.1 [Gorilla gorilla gorilla] >XP_004273522.1 PREDICTED: histone H3.1 isoform X2 [Orcinus orca] >XP_004273528.1 PREDICTED: histone H3.1 [Orcinus orca] >XP_004286146.1 PREDICTED: histone H3.1 [Orcinus orca] >XP_004406571.1 PREDICTED: histone H3.1 isoform X2 [Odobenus rosmarus divergens] >XP_004413708.1 PREDICTED: histone H3.1 [Odobenus rosmarus divergens] >XP_004432107.1 PREDICTED: histone H3.1 [Ceratotherium simum simum] >XP_004463548.1 histone H3.1 [Dasypus novemcinctus] >XP_004463555.1 histone H3.1 [Dasypus novemcinctus] >XP_004463558.1 histone H3.1 [Dasypus novemcinctus] >XP_004596554.1 PREDICTED: histone H3.1 [Ochotona princeps] >XP_004598446.1 PREDICTED: histone H3.1 [Ochotona princeps] >XP_004621954.1 PREDICTED: histone H3.1 [Sorex araneus] >XP_004695477.1 PREDICTED: histone H3.1 [Condylura cristata] >XP_005196706.1 PREDICTED: histone H3.1 [Bos taurus] >XP_005223855.1 PREDICTED: histone H3.1 [Bos taurus] >XP_005355009.1 PREDICTED: histone H3.1 [Microtus ochrogaster] >XP_005369967.1 PREDICTED: histone H3.1 [Microtus ochrogaster] >XP_005403349.1 PREDICTED: histone H3.1 [Chinchilla lanigera] >XP_005553796.1 PREDICTED: histone H3.1 [Macaca fascicularis] >XP_005553872.1 PREDICTED: histone H3.1 [Macaca fascicularis] >XP_005603668.1 histone H3.1 [Equus caballus] >XP_005640158.1 histone H3.1 [Canis lupus familiaris] >XP_005696812.1 PREDICTED: histone H3.1 [Capra hircus] >XP_005867474.1 PREDICTED: histone H3.1 [Myotis brandtii] >XP_005960876.1 PREDICTED: histone H3.1-like [Pantholops hodgsonii] >XP_006105758.1 histone H3.1 [Myotis lucifugus] >XP_006107726.1 histone H3.1 [Myotis lucifugus] >XP_006182259.1 PREDICTED: histone H3.1 [Camelus ferus] >XP_006168566.1 PREDICTED: histone H3.1 [Tupaia chinensis] >XP_006760038.1 PREDICTED: histone H3.1 [Myotis davidii] >XP_006735958.1 PREDICTED: histone H3.1-like [Leptonychotes weddellii] >XP_006735982.1 PREDICTED: histone H3.1-like [Leptonychotes weddellii] >XP_006736830.1 PREDICTED: histone H3.1-like [Leptonychotes weddellii] >XP_006888684.1 PREDICTED: histone H3.1-like [Elephantulus edwardii] >XP_006888694.1 PREDICTED: histone H3.1-like [Elephantulus edwardii] >XP_006872832.1 PREDICTED: histone H3.1-like [Chrysochloris asiatica] >XP_006872875.1 PREDICTED: histone H3.1-like [Chrysochloris asiatica] >XP_006872879.1 PREDICTED: histone H3.1-like [Chrysochloris asiatica] >XP_006931427.1 histone H3.1 [Felis catus] >XP_006931452.1 histone H3.1 [Felis catus] >XP_006993204.1 PREDICTED: histone H3.1 [Peromyscus maniculatus bairdii] >XP_006999014.1 PREDICTED: histone H3.1 [Peromyscus maniculatus bairdii] >XP_007105896.1 histone H3.1 [Physeter catodon] >XP_006040927.1 PREDICTED: histone H3.1-like [Bubalus bubalis] >XP_006048071.1 PREDICTED: histone H3.1-like [Bubalus bubalis] >XP_006048085.1 PREDICTED: histone H3.1-like [Bubalus bubalis] >XP_007177426.1 PREDICTED: histone H3.1-like isoform X2 [Balaenoptera acutorostrata scammoni] >XP_007471300.1 PREDICTED: histone H3.1-like isoform X2 [Lipotes vexillifer] >XP_007471303.1 PREDICTED: histone H3.1-like isoform X2 [Lipotes vexillifer] >XP_007449313.1 PREDICTED: histone H3.1-like [Lipotes vexillifer] >XP_007534631.1 PREDICTED: histone H3.1 isoform X2 [Erinaceus europaeus] >XP_007534641.1 PREDICTED: histone H3.1 [Erinaceus europaeus] >XP_007534650.1 PREDICTED: histone H3.1 [Erinaceus europaeus] >XP_007634651.1 PREDICTED: histone H3.1 isoform X2 [Cricetulus griseus] >XP_007634658.1 PREDICTED: histone H3.1 [Cricetulus griseus] >XP_007948021.1 PREDICTED: histone H3.1 [Orycteropus afer afer] >XP_007948037.1 PREDICTED: histone H3.1 isoform X2 [Orycteropus afer afer] >XP_007948048.1 PREDICTED: histone H3.1 [Orycteropus afer afer] >XP_007971599.1 PREDICTED: histone H3.1 [Chlorocebus sabaeus] >XP_007971664.1 PREDICTED: histone H3.1 [Chlorocebus sabaeus] >XP_007971678.1 PREDICTED: histone H3.1 [Chlorocebus sabaeus] >XP_008070424.1 histone H3.1 [Carlito syrichta] >XP_008260692.1 PREDICTED: histone H3.1 [Oryctolagus cuniculus] >XP_008526336.1 PREDICTED: histone H3.1 isoform X1 [Equus przewalskii] >XP_008526339.1 PREDICTED: histone H3.1 [Equus przewalskii] >XP_008539711.1 PREDICTED: histone H3.1 [Equus przewalskii] >XP_008539720.1 PREDICTED: histone H3.1 [Equus przewalskii] >XP_008566068.1 PREDICTED: histone H3.1 [Galeopterus variegatus] >XP_008580157.1 PREDICTED: histone H3.1 [Galeopterus variegatus] >XP_008585846.1 PREDICTED: histone H3.1 [Galeopterus variegatus] >XP_008585848.1 PREDICTED: histone H3.1 [Galeopterus variegatus] >XP_008691196.1 PREDICTED: histone H3.1 [Ursus maritimus] >XP_008691242.1 PREDICTED: histone H3.1 [Ursus maritimus] >XP_008824859.1 PREDICTED: histone H3.1 [Nannospalax galili] >XP_008992035.1 PREDICTED: histone H3.1 [Callithrix jacchus] >XP_008958127.1 PREDICTED: histone H3.1 [Pan paniscus] >XP_009202845.1 histone H3.1 [Papio anubis] >XP_009202890.1 histone H3.1 [Papio anubis] >XP_009239775.1 histone H3.1 [Pongo abelii] >XP_009239776.1 histone H3.1 [Pongo abelii] >XP_009239779.1 histone H3.1 isoform X2 [Pongo abelii] >XP_009239782.1 histone H3.1 [Pongo abelii] >XP_010362889.1 PREDICTED: histone H3.1 isoform X2 [Rhinopithecus roxellana] >XP_010362939.1 PREDICTED: histone H3.1 [Rhinopithecus roxellana] >XP_010362950.1 PREDICTED: histone H3.1 [Rhinopithecus roxellana] >XP_010362991.1 PREDICTED: histone H3.1 [Rhinopithecus roxellana] >XP_010363131.1 PREDICTED: histone H3.1 [Rhinopithecus roxellana] >XP_010363154.1 PREDICTED: histone H3.1 [Rhinopithecus roxellana] >XP_010372527.1 PREDICTED: histone H3.1 [Rhinopithecus roxellana] >XP_010336290.1 PREDICTED: histone H3.1 [Saimiri boliviensis boliviensis] >XP_010331010.1 PREDICTED: histone H3.1 [Saimiri boliviensis boliviensis] >XP_010621292.1 PREDICTED: histone H3.1 [Fukomys damarensis] >XP_010823755.1 PREDICTED: histone H3.1 [Bos taurus] >XP_010816767.1 PREDICTED: histone H3.1 [Bos taurus] >XP_010841730.1 PREDICTED: histone H3.1 [Bison bison bison] >XP_010841740.1 PREDICTED: histone H3.1 [Bison bison bison] >XP_010841742.1 PREDICTED: histone H3.1 [Bison bison bison] >XP_010973015.1 PREDICTED: histone H3.1 [Camelus dromedarius] >XP_011280366.1 histone H3.1 [Felis catus] >XP_011364639.1 histone H3.1 [Pteropus vampyrus] >XP_011800326.1 PREDICTED: histone H3.1 [Colobus angolensis palliatus] >XP_011846629.1 PREDICTED: histone H3.1 [Mandrillus leucophaeus] >XP_011846639.1 PREDICTED: histone H3.1 [Mandrillus leucophaeus] >XP_011821826.1 PREDICTED: histone H3.1 [Mandrillus leucophaeus] >XP_011821857.1 PREDICTED: histone H3.1 [Mandrillus leucophaeus] >XP_011818219.1 PREDICTED: histone H3.1 [Colobus angolensis palliatus] >XP_011818249.1 PREDICTED: histone H3.1 [Colobus angolensis palliatus] >XP_011818250.1 PREDICTED: histone H3.1 [Colobus angolensis palliatus] >XP_011818256.1 PREDICTED: histone H3.1 [Colobus angolensis palliatus] >XP_011818257.1 PREDICTED: histone H3.1 [Colobus angolensis palliatus] >XP_011931479.1 PREDICTED: histone H3.1 [Cercocebus atys] >XP_011756517.1 histone H3.1 [Macaca nemestrina] >XP_011886927.1 PREDICTED: histone H3.1 [Cercocebus atys] >XP_011886948.1 PREDICTED: histone H3.1 [Cercocebus atys] >XP_011741070.1 histone H3.1 [Macaca nemestrina] >XP_012020691.1 PREDICTED: histone H3.1 [Ovis aries musimon] >XP_012020694.1 PREDICTED: histone H3.1 [Ovis aries musimon] >XP_012313999.1 histone H3.1 [Aotus nancymaae] >XP_012321302.1 histone H3.1 [Aotus nancymaae] >XP_012321316.1 histone H3.1 [Aotus nancymaae] >XP_012364620.1 PREDICTED: histone H3.1 [Nomascus leucogenys] >XP_012389798.1 PREDICTED: histone H3.1 [Orcinus orca] >XP_012389800.1 PREDICTED: histone H3.1 [Orcinus orca] >XP_012389801.1 PREDICTED: histone H3.1 [Orcinus orca] >XP_012414116.1 histone H3.1 [Trichechus manatus latirostris] >XP_012419976.1 PREDICTED: histone H3.1 [Odobenus rosmarus divergens] >XP_012422569.1 PREDICTED: histone H3.1 [Odobenus rosmarus divergens] >XP_012494031.1 PREDICTED: histone H3.1 [Propithecus coquereli] >XP_012494058.1 PREDICTED: histone H3.1 [Propithecus coquereli] >XP_012494059.1 PREDICTED: histone H3.1 [Propithecus coquereli] >XP_012494089.1 PREDICTED: histone H3.1 [Propithecus coquereli] >XP_012494118.1 PREDICTED: histone H3.1 [Propithecus coquereli] >XP_012596778.1 histone H3.1 [Microcebus murinus] >XP_012596779.1 histone H3.1 [Microcebus murinus] >XP_012597463.1 histone H3.1 [Microcebus murinus] >XP_012597510.1 histone H3.1 [Microcebus murinus] >XP_012660049.1 histone H3.1 [Otolemur garnettii] >XP_012668244.1 histone H3.1 [Otolemur garnettii] >XP_012791262.1 PREDICTED: histone H3.1 [Sorex araneus] >XP_013204542.1 PREDICTED: histone H3.1 [Microtus ochrogaster] >XP_013377252.1 PREDICTED: histone H3.1 isoform X1 [Chinchilla lanigera] >XP_013377253.1 PREDICTED: histone H3.1 isoform X2 [Chinchilla lanigera] >XP_013359239.1 PREDICTED: histone H3.1 [Chinchilla lanigera] >XP_013359240.1 PREDICTED: histone H3.1 [Chinchilla lanigera] >XP_013359241.1 PREDICTED: histone H3.1 [Chinchilla lanigera] >XP_013359242.1 PREDICTED: histone H3.1 [Chinchilla lanigera] >XP_013844399.1 histone H3.1 [Sus scrofa] >XP_013966115.1 histone H3.1 [Canis lupus familiaris] >XP_014303293.1 histone H3.1 [Myotis lucifugus] >XP_014303295.1 histone H3.1 [Myotis lucifugus] >XP_014412653.1 PREDICTED: histone H3.1 [Camelus ferus] >XP_014412654.1 PREDICTED: histone H3.1 [Camelus ferus] >XP_014412655.1 PREDICTED: histone H3.1 [Camelus ferus] >XP_014448833.1 PREDICTED: histone H3.1 [Tupaia chinensis] >XP_014589723.1 histone H3.1 [Equus caballus] >XP_014589724.1 histone H3.1 [Equus caballus] >XP_014644175.1 PREDICTED: histone H3.1 [Ceratotherium simum simum] >XP_014644187.1 PREDICTED: histone H3.1 [Ceratotherium simum simum] >XP_014651789.1 PREDICTED: histone H3.1 [Ceratotherium simum simum] >XP_014707042.1 PREDICTED: histone H3.1 [Equus asinus] >XP_014707043.1 PREDICTED: histone H3.1 [Equus asinus] >XP_014707059.1 PREDICTED: histone H3.1 [Equus asinus] >XP_014684665.1 PREDICTED: histone H3.1 [Equus asinus] >XP_014684678.1 PREDICTED: histone H3.1 [Equus asinus] >XP_014941928.1 PREDICTED: histone H3.1 [Acinonyx jubatus] >XP_014944871.1 PREDICTED: histone H3.1 [Ovis aries musimon] >XP_014945807.1 PREDICTED: histone H3.1 [Ovis aries musimon] >XP_014945808.1 PREDICTED: histone H3.1 [Ovis aries musimon] >XP_014958044.1 PREDICTED: histone H3.1 [Ovis aries] >XP_014991250.1 PREDICTED: histone H3.1 [Macaca mulatta] >XP_015305243.1 PREDICTED: histone H3.1 [Macaca fascicularis] >XP_015305280.1 PREDICTED: histone H3.1 [Macaca fascicularis] >XP_015305281.1 PREDICTED: histone H3.1 [Macaca fascicularis] >XP_015315463.1 PREDICTED: histone H3.1 [Bos taurus] >XP_015324501.1 PREDICTED: histone H3.1 [Bos taurus] >XP_015324502.1 PREDICTED: histone H3.1 [Bos taurus] >XP_015349591.1 PREDICTED: histone H3.1 [Marmota marmota marmota] >XP_015349602.1 PREDICTED: histone H3.1 [Marmota marmota marmota] >XP_015349636.1 PREDICTED: histone H3.1 [Marmota marmota marmota] >XP_015416977.1 PREDICTED: histone H3.1 [Myotis davidii] >XP_015842141.1 PREDICTED: histone H3.1 [Peromyscus maniculatus bairdii] >XP_015988254.1 PREDICTED: histone H3.1 [Rousettus aegyptiacus] >XP_015988386.1 PREDICTED: histone H3.1 [Rousettus aegyptiacus] >XP_015988498.1 PREDICTED: histone H3.1 [Rousettus aegyptiacus] >XP_015989362.1 PREDICTED: histone H3.1 [Rousettus aegyptiacus] >XP_015989480.1 PREDICTED: histone H3.1 [Rousettus aegyptiacus] >XP_016021800.1 PREDICTED: histone H3.1 [Rousettus aegyptiacus] >XP_016071754.1 PREDICTED: histone H3.1 isoform X1 [Miniopterus natalensis] >XP_016071756.1 PREDICTED: histone H3.1 isoform X2 [Miniopterus natalensis] >XP_016071757.1 PREDICTED: histone H3.1 [Miniopterus natalensis] >XP_016071758.1 PREDICTED: histone H3.1 [Miniopterus natalensis] >XP_016810514.1 histone H3.1 [Pan troglodytes] >XP_016810551.1 histone H3.1 [Pan troglodytes] >XP_017193171.1 PREDICTED: histone H3.1 [Oryctolagus cuniculus] >XP_017200429.1 PREDICTED: histone H3.1 [Oryctolagus cuniculus] >XP_017360672.1 PREDICTED: histone H3.1 [Cebus capucinus imitator] >XP_017443213.1 PREDICTED: histone H3.1 [Rattus norvegicus] >XP_017443230.1 PREDICTED: histone H3.1 isoform X2 [Rattus norvegicus] >XP_017456209.1 PREDICTED: histone H3.1 [Rattus norvegicus] >XP_017520891.1 PREDICTED: histone H3.1 [Manis javanica] >XP_017520903.1 PREDICTED: histone H3.1 [Manis javanica] >XP_017704637.1 PREDICTED: histone H3.1 [Rhinopithecus bieti] >XP_017704638.1 PREDICTED: histone H3.1 [Rhinopithecus bieti] >XP_017704685.1 PREDICTED: histone H3.1 [Rhinopithecus bieti] >XP_017744654.1 PREDICTED: histone H3.1 [Rhinopithecus bieti] >XP_017827080.1 PREDICTED: histone H3.1 [Callithrix jacchus] >XP_017894002.1 PREDICTED: histone H3.1 [Capra hircus] >XP_017894030.1 PREDICTED: histone H3.1 [Capra hircus] >XP_017894031.1 PREDICTED: histone H3.1 [Capra hircus] >XP_018875515.1 PREDICTED: histone H3.1 [Gorilla gorilla gorilla] >XP_018884674.1 PREDICTED: histone H3.1 [Gorilla gorilla gorilla] >XP_019280713.1 PREDICTED: histone H3.1 [Panthera pardus] >XP_019280714.1 PREDICTED: histone H3.1 [Panthera pardus] >XP_019280715.1 PREDICTED: histone H3.1 [Panthera pardus] >XP_019280716.1 PREDICTED: histone H3.1 [Panthera pardus] >XP_019280761.1 PREDICTED: histone H3.1 [Panthera pardus] >XP_019486812.1 PREDICTED: histone H3.1 [Hipposideros armiger] >XP_019486813.1 PREDICTED: histone H3.1 [Hipposideros armiger] >XP_019486815.1 PREDICTED: histone H3.1 [Hipposideros armiger] >XP_019486838.1 PREDICTED: histone H3.1 [Hipposideros armiger] >XP_019569765.1 PREDICTED: histone H3.1 [Rhinolophus sinicus] >XP_019663399.1 PREDICTED: histone H3.1 [Ailuropoda melanoleuca] >XP_019664823.1 PREDICTED: histone H3.1 [Ailuropoda melanoleuca] >XP_019687254.1 histone H3.1 [Felis catus] >XP_019840850.1 PREDICTED: histone H3.1 [Bos indicus] >XP_019841097.1 PREDICTED: histone H3.1 [Bos indicus] >XP_019800466.1 PREDICTED: histone H3.1 [Tursiops truncatus] >XP_019800698.1 PREDICTED: histone H3.1 [Tursiops truncatus] >XP_020727346.1 histone H3.1 [Odocoileus virginianus texanus] >XP_020742301.1 histone H3.1 [Odocoileus virginianus texanus] >XP_020742309.1 histone H3.1 [Odocoileus virginianus texanus] >XP_020767078.1 histone H3.1 [Odocoileus virginianus texanus] >XP_020955496.1 histone H3.1 [Sus scrofa] >XP_021071620.1 histone H3.1 [Mus pahari] >XP_021036735.1 histone H3.1 [Mus caroli] >XP_021080732.1 histone H3.1 [Mesocricetus auratus] >XP_021116480.1 histone H3.1 [Heterocephalus glaber] >XP_021511771.1 histone H3.1 [Meriones unguiculatus] >XP_021552519.1 histone H3.1 [Neomonachus schauinslandi] >XP_021523296.1 histone H3.1 isoform X2 [Aotus nancymaae] >XP_021523308.1 histone H3.1 [Aotus nancymaae] >XP_021590091.1 histone H3.1 [Ictidomys tridecemlineatus] >XP_021590092.1 histone H3.1 [Ictidomys tridecemlineatus] >XP_022270157.1 histone H3.1 [Canis lupus familiaris] >XP_022270320.1 histone H3.1 [Canis lupus familiaris] >XP_022270321.1 histone H3.1 [Canis lupus familiaris] >XP_022346254.1 histone H3.1 [Enhydra lutris kenyoni] >XP_022346255.1 histone H3.1 [Enhydra lutris kenyoni] >XP_022346256.1 histone H3.1 [Enhydra lutris kenyoni] >XP_022346257.1 histone H3.1 [Enhydra lutris kenyoni] >XP_022417861.1 histone H3.1 [Delphinapterus leucas] >XP_022417975.1 histone H3.1 [Delphinapterus leucas] >XP_022418004.1 histone H3.1 [Delphinapterus leucas] >XP_023065418.1 histone H3.1 [Piliocolobus tephrosceles] >XP_023065474.1 histone H3.1 [Piliocolobus tephrosceles] >XP_023047417.1 histone H3.1 [Piliocolobus tephrosceles] >XP_023368434.1 histone H3.1 [Otolemur garnettii] >XP_023411474.1 histone H3.1 [Loxodonta africana] >XP_023411482.1 histone H3.1 [Loxodonta africana] >XP_023411483.1 histone H3.1 [Loxodonta africana] >XP_023411484.1 histone H3.1 [Loxodonta africana] >XP_023396021.1 histone H3.1 [Loxodonta africana] >XP_023390167.1 histone H3.1 [Pteropus vampyrus] >XP_023594137.1 histone H3.1 [Trichechus manatus latirostris] >XP_023594139.1 histone H3.1 [Trichechus manatus latirostris] >XP_023594140.1 histone H3.1 [Trichechus manatus latirostris] >XP_023977602.1 histone H3.1 [Physeter catodon] >XP_023977603.1 histone H3.1 [Physeter catodon] >XP_024103846.1 histone H3.1 [Pongo abelii] >XP_024103863.1 histone H3.1 [Pongo abelii] >XP_024212845.1 histone H3.1 [Pan troglodytes] >XP_024426001.1 histone H3.1 [Desmodus rotundus] >XP_024426002.1 histone H3.1 isoform X1 [Desmodus rotundus] >XP_024426003.1 histone H3.1 isoform X2 [Desmodus rotundus] >XP_024426004.1 histone H3.1 [Desmodus rotundus] >XP_024426038.1 histone H3.1 [Desmodus rotundus] >XP_024426039.1 histone H3.1 [Desmodus rotundus] >XP_024426040.1 histone H3.1 [Desmodus rotundus] >XP_024607774.1 histone H3.1 [Neophocaena asiaeorientalis asiaeorientalis] >XP_024620086.1 histone H3.1 [Neophocaena asiaeorientalis asiaeorientalis] >XP_024648758.1 histone H3.1 [Macaca nemestrina] >XP_024648759.1 histone H3.1 [Macaca nemestrina] >P68431.2 RecName: Full=Histone H3.1; AltName: Full=Histone H3/a; AltName: Full=Histone H3/b; AltName: Full=Histone H3/c; AltName: Full=Histone H3/d; AltName: Full=Histone H3/f; AltName: Full=Histone H3/h; AltName: Full=Histone H3/i; AltName: Full=Histone H3/j; AltName: Full=Histone H3/k; AltName: Full=Histone H3/l >P68432.2 RecName: Full=Histone H3.1 >P68433.2 RecName: Full=Histone H3.1 >Q6LED0.3 RecName: Full=Histone H3.1 >Q6LBF0.3 RecName: Full=Histone H3.1 >pir||I57019 H3 histone - rat >pir||I49398 histone H3.1 protein - shrew mouse >2CV5_A Chain A, Crystal Structure Of Human Nucleosome Core Particle >2CV5_E Chain E, Crystal Structure Of Human Nucleosome Core Particle >1U35_A Chain A, Crystal Structure Of The Nucleosome Core Particle Containing The Histone Domain Of Macroh2a >1U35_E Chain E, Crystal Structure Of The Nucleosome Core Particle Containing The Histone Domain Of Macroh2a >5C3I_B Chain B, Crystal Structure Of The Quaternary Complex Of Histone H3-h4 Heterodimer With Chaperone Asf1 And The Replicative Helicase Subunit Mcm2 >5C3I_F Chain F, Crystal Structure Of The Quaternary Complex Of Histone H3-h4 Heterodimer With Chaperone Asf1 And The Replicative Helicase Subunit Mcm2 >5C3I_J Chain J, Crystal Structure Of The Quaternary Complex Of Histone H3-h4 Heterodimer With Chaperone Asf1 And The Replicative Helicase Subunit Mcm2 >5C3I_N Chain N, Crystal Structure Of The Quaternary Complex Of Histone H3-h4 Heterodimer With Chaperone Asf1 And The Replicative Helicase Subunit Mcm2 >5C3I_R Chain R, Crystal Structure Of The Quaternary Complex Of Histone H3-h4 Heterodimer With Chaperone Asf1 And The Replicative Helicase Subunit Mcm2 >5C3I_V Chain V, Crystal Structure Of The Quaternary Complex Of Histone H3-h4 Heterodimer With Chaperone Asf1 And The Replicative Helicase Subunit Mcm2 >5XF3_A Chain A, Nucleosome core particle with an adduct of a binuclear RAPTA (Ru-arene-phosphaadamantane) compound having a 1,2-diphenylethylenediamine linker (R,R-configuration) >5XF3_E Chain E, Nucleosome core particle with an adduct of a binuclear RAPTA (Ru-arene-phosphaadamantane) compound having a 1,2-diphenylethylenediamine linker (R,R-configuration) >5XF4_A Chain A, Nucleosome core particle with an adduct of a binuclear RAPTA (Ru-arene-phosphaadamantane) compound having a 1,2-diphenylethylenediamine linker (S,S-configuration) >5XF4_E Chain E, Nucleosome core particle with an adduct of a binuclear RAPTA (Ru-arene-phosphaadamantane) compound having a 1,2-diphenylethylenediamine linker (S,S-configuration) >5XF5_A Chain A, Nucleosome core particle with an adduct of a binuclear RAPTA (Ru-arene-phosphaadamantane) compound having a 1,2-diphenylethylenediamine linker (R,S-configuration) >5XF5_E Chain E, Nucleosome core particle with an adduct of a binuclear RAPTA (Ru-arene-phosphaadamantane) compound having a 1,2-diphenylethylenediamine linker (R,S-configuration) >6ETX_I Chain I, Cryo-EM structure of the human INO80 complex bound to nucleosome >6ETX_M Chain M, Cryo-EM structure of the human INO80 complex bound to nucleosome >CAA40407.1 histone H3 [Homo sapiens] >CAA24952.1 unnamed protein product [Homo sapiens] >CAA25839.1 unnamed protein product [Mus musculus] >CAA34512.1 unnamed protein product [Mus musculus] >AAA63185.1 histone H3.1 [Homo sapiens] >AAA19824.1 H3 histone [Rattus norvegicus] >AAA37811.1 histone H3 [Mus musculus] >AAA37813.1 histone H3 [Mus musculus] >CAA56572.1 histone 3.1 protein [Mus pahari] >CAA56571.1 histone H3.1 protein [Mus pahari] >CAA86403.1 histone H3a [Homo sapiens] >AAB04763.1 histone H3.1-I [Mus musculus] >AAB04765.1 histone H3.1-D [Mus musculus] >CAB02547.1 histone H3 [Homo sapiens] >CAB02548.1 histone H3 [Homo sapiens] >CAB06030.1 histone H3 [Homo sapiens] >CAB06032.1 histone H3 [Homo sapiens] >CAA58540.1 histone H3 [Homo sapiens] >CAA72968.1 Histone H3 [Mus musculus] >BAB24722.1 unnamed protein product [Mus musculus] >BAB31493.1 unnamed protein product [Mus musculus] >AAH31333.1 Histone cluster 1, H3d [Homo sapiens] >AAN10051.1 histone H3 [Homo sapiens] >AAN10052.1 histone H3 [Homo sapiens] >AAN10053.1 histone H3 [Homo sapiens] >AAN10054.1 histone H3 [Homo sapiens] >AAN10055.1 histone H3 [Homo sapiens] >AAN10056.1 histone H3 [Homo sapiens] >AAN10057.1 histone H3 [Homo sapiens] >AAN10058.1 histone H3 [Homo sapiens] >AAN10059.1 histone H3 [Homo sapiens] >AAN10060.1 histone H3 [Homo sapiens] >AAO06254.1 histone protein Hist1h3h [Mus musculus] >AAO06255.1 histone protein Hist1h3i [Mus musculus] >AAO06256.1 histone protein Hist1h3g [Mus musculus] >AAO06262.1 histone protein Hist1h3a [Mus musculus] >AAH66247.1 Histone cluster 1, H3a [Homo sapiens] >AAH66245.1 Histone cluster 1, H3a [Homo sapiens] >AAH66246.1 Histone cluster 1, H3a [Homo sapiens] >AAH67491.1 Histone cluster 1, H3a [Homo sapiens] >AAH67492.1 Histone cluster 1, H3f [Homo sapiens] >AAH67490.1 Histone cluster 1, H3a [Homo sapiens] >AAH69133.1 Histone cluster 1, H3b [Homo sapiens] >AAH69818.1 Histone cluster 1, H3f [Homo sapiens] >AAH69303.1 Histone cluster 1, H3a [Homo sapiens] >CAG46656.1 HIST1H3A [Homo sapiens] >CAG46780.1 HIST1H3F [Homo sapiens] >CAG46808.1 HIST1H3F, partial [Homo sapiens] >CAG46811.1 HIST1H3E, partial [Homo sapiens] >AAH96128.1 Histone cluster 1, H3h [Homo sapiens] >AAH96130.1 Histone cluster 1, H3h [Homo sapiens] >AAH96133.1 Histone cluster 1, H3b [Homo sapiens] >AAH96131.1 Histone cluster 1, H3f [Homo sapiens] >AAH96129.1 Histone cluster 1, H3h [Homo sapiens] >AAH96132.1 Histone cluster 1, H3b [Homo sapiens] >AAH96134.1 Histone cluster 1, H3b [Homo sapiens] >AAH99630.1 Histone cluster 1, H3b [Homo sapiens] >BAE33402.1 unnamed protein product [Mus musculus] >AAI11922.1 HIST1H3J protein, partial [synthetic construct] >AAH69305.2 Histone cluster 1, H3i [Homo sapiens] >AAI16384.1 Hist1h3i protein [Mus musculus] >AAI15817.1 Hist1h3a protein [Mus musculus] >AAI25356.1 Histone cluster 1, H3g [Mus musculus] >AAI25358.1 Histone cluster 1, H3g [Mus musculus] >AAI27611.1 HIST1H3C protein [Homo sapiens] >EAW55508.1 histone 1, H3a [Homo sapiens] >EAW55511.1 histone 1, H3b [Homo sapiens] >EAW55514.1 histone 1, H3c [Homo sapiens] >EAW55539.1 hCG2043425 [Homo sapiens] >EAW55547.1 hCG17998 [Homo sapiens] >EAW55551.1 histone 1, H3f [Homo sapiens] >EAW55553.1 histone 1, H3g [Homo sapiens] >EAX03108.1 histone 1, H3h [Homo sapiens] >EAX03120.1 histone 1, H3i [Homo sapiens] >EAX03122.1 histone 1, H3j [Homo sapiens] >ABM83721.1 histone 1, H3d [synthetic construct] >ABM87041.1 histone 1, H3d, partial [synthetic construct] >EDL32535.1 mCG16990 [Mus musculus] >EDL32561.1 mCG7740 [Mus musculus] >EDL32629.1 mCG23034 [Mus musculus] >EDL32634.1 mCG23030 [Mus musculus] >AAI43047.1 HIST1H3H protein [Homo sapiens] >EDL84559.1 rCG23084 [Rattus norvegicus] >EDL84566.1 rCG23116 [Rattus norvegicus] >EDL86564.1 rCG45152 [Rattus norvegicus] >EDL86592.1 rCG45200 [Rattus norvegicus] >AAI48251.1 HIST1H3H protein [Homo sapiens] >AAI48244.1 HIST1H3H protein [Homo sapiens] >ABZ92502.1 histone cluster 1, H3e, partial [synthetic construct] >ABZ92503.1 histone cluster 1, H3g, partial [synthetic construct] >ABZ92504.1 histone cluster 1, H3h, partial [synthetic construct] >AAI60079.1 Histone cluster 1, H3c [synthetic construct] >BAG36628.1 unnamed protein product [Homo sapiens] >BAG36832.1 unnamed protein product [Homo sapiens] >BAG34929.1 unnamed protein product [Homo sapiens] >BAG38198.1 unnamed protein product [Homo sapiens] >BAG73248.1 histone cluster 1, H3b, partial [synthetic construct] >EFB20874.1 hypothetical protein PANDA_018571, partial [Ailuropoda melanoleuca] >EFB21590.1 hypothetical protein PANDA_016843, partial [Ailuropoda melanoleuca] >DAA16173.1 TPA: histone cluster 1, H3f-like [Bos taurus] >DAA16175.1 TPA: histone cluster 1, H3f-like [Bos taurus] >DAA16178.1 TPA: histone cluster 1, H3f-like [Bos taurus] >DAA16187.1 TPA: histone cluster 1, H3f-like [Bos taurus] >DAA16190.1 TPA: histone cluster 1, H3f-like [Bos taurus] >DAA16192.1 TPA: histone cluster 1, H3f-like [Bos taurus] >DAA16251.1 TPA: histone cluster 1, H3f-like [Bos taurus] >DAA16255.1 TPA: histone cluster 1, H3f-like [Bos taurus] >DAA16263.1 TPA: histone cluster 1, H3f-like [Bos taurus] >BAJ21191.1 histone cluster 1, H3e, partial [synthetic construct] >BAJ21192.1 histone cluster 1, H3g, partial [synthetic construct] >BAJ20241.1 histone cluster 1, H3d, partial [synthetic construct] >ADQ32889.1 histone cluster 1, H3a, partial [synthetic construct] >ADR82713.1 histone cluster 1, H3j, partial [synthetic construct] >AEI00724.1 histone cluster 1 [Sus scrofa] >EGV96118.1 Histone H3.1 [Cricetulus griseus] >EGV96123.1 Histone H3.1 [Cricetulus griseus] >EHB11497.1 Histone H3.1 [Heterocephalus glaber] >EHB13137.1 Histone H3.1 [Heterocephalus glaber] >EHH18008.1 Histone H3/a [Macaca mulatta] >EHH18011.1 Histone H3/a [Macaca mulatta] >EHH18014.1 Histone H3/a [Macaca mulatta] >EHH18031.1 Histone H3/a [Macaca mulatta] >EHH18034.1 Histone H3/a [Macaca mulatta] >EHH18038.1 hypothetical protein EGK_14567 [Macaca mulatta] >EHH18060.1 Histone H3/a [Macaca mulatta] >EHH18068.1 hypothetical protein EGK_14603 [Macaca mulatta] >EHH18070.1 Histone H3/a [Macaca mulatta] >EHH52780.1 Histone H3/a [Macaca fascicularis] >EHH52782.1 Histone H3/a [Macaca fascicularis] >EHH52785.1 Histone H3/a [Macaca fascicularis] >EHH52796.1 Histone H3/a [Macaca fascicularis] >EHH52802.1 Histone H3/a [Macaca fascicularis] >EHH52809.1 hypothetical protein EGM_13324 [Macaca fascicularis] >EHH52823.1 Histone H3/a [Macaca fascicularis] >EHH52829.1 Histone H3/a [Macaca fascicularis] >EHH52831.1 Histone H3/a [Macaca fascicularis] >ELK02659.1 Histone H3.1 [Pteropus alecto] >ELK02661.1 Histone H3.1 [Pteropus alecto] >ELK33055.1 Histone H3.1 [Myotis davidii] >ELK33071.1 Histone H3.1 [Myotis davidii] >ELR58911.1 Histone H3.1 [Bos mutus] >ELV10780.1 Histone H3.1 [Tupaia chinensis] >ELV13504.1 Histone H3.1 [Tupaia chinensis] >EPQ08520.1 Histone H3.1 [Myotis brandtii] >EPY83084.1 histone 1, H2ai isoform 3-like protein [Camelus ferus] >EPY83089.1 histone 1, H2ai isoform 3-like protein [Camelus ferus] >EPY83097.1 histone 1, H2ai isoform 3-like protein [Camelus ferus] >EPY83116.1 histone 1, H2ai isoform 3-like protein [Camelus ferus] >ERE77555.1 histone H3.1-like protein [Cricetulus griseus] >AHJ25763.1 histone H3.1-like protein, partial [Panthera tigris altaica] >AIC50095.1 HIST1H3A, partial [synthetic construct] >AIC50096.1 HIST1H3C, partial [synthetic construct] >AIC50097.1 HIST1H3E, partial [synthetic construct] >AIC50098.1 HIST1H3G, partial [synthetic construct] >AIC50099.1 HIST1H3H, partial [synthetic construct] >AIC50100.1 HIST1H3B, partial [synthetic construct] >AIC50245.1 HIST1H3F, partial [synthetic construct] >AIC55396.1 HIST1H3H, partial [synthetic construct] >AIC55502.1 HIST1H3F, partial [synthetic construct] >AIC55503.1 HIST1H3F, partial [synthetic construct] >KFO28172.1 Histone H3.1 [Fukomys damarensis] >KFO33864.1 Histone H3.1 [Fukomys damarensis] >KFO33888.1 Histone H3.1 [Fukomys damarensis] >SJX25998.1 unnamed protein product, partial [Human ORFeome Gateway entry vector] >SJX26074.1 unnamed protein product, partial [Human ORFeome Gateway entry vector] >SJX26110.1 unnamed protein product, partial [Human ORFeome Gateway entry vector] >SJX26998.1 unnamed protein product, partial [Human ORFeome Gateway entry vector] >SJX26562.1 unnamed protein product, partial [Human ORFeome Gateway entry vector] >SJX26608.1 unnamed protein product, partial [Human ORFeome Gateway entry vector] >SJX40466.1 unnamed protein product, partial [Human ORFeome Gateway entry vector] >SJX40480.1 unnamed protein product, partial [Human ORFeome Gateway entry vector] >SJX42648.1 unnamed protein product, partial [Human ORFeome Gateway entry vector] >SJX42672.1 unnamed protein product, partial [Human ORFeome Gateway entry vector] >PNI24977.1 HIST1H3A isoform 1 [Pan troglodytes] >PNI24980.1 HIST1H3B isoform 1 [Pan troglodytes] >PNI24983.1 HIST1H3C isoform 1 [Pan troglodytes] >PNI25010.1 HIST1H3D isoform 1 [Pan troglodytes] >PNI25015.1 HIST1H3E isoform 1 [Pan troglodytes] >PNI25016.1 HIST1H3E isoform 2 [Pan troglodytes] >PNI25020.1 HIST1H3F isoform 1 [Pan troglodytes] >PNI25022.1 HIST1H3G isoform 1 [Pan troglodytes] >PNI76171.1 HIST1H3H isoform 1 [Pan troglodytes] >PNI76179.1 HIST1H3I isoform 1 [Pan troglodytes] >PNI76181.1 HIST1H3J isoform 1 [Pan troglodytes] >PNJ15788.1 HIST1H3A isoform 1 [Pongo abelii] >PNJ15791.1 HIST1H3B isoform 1 [Pongo abelii] >PNJ15794.1 HIST1H3C isoform 1 [Pongo abelii] >PNJ15821.1 HIST1H3D isoform 1 [Pongo abelii] >PNJ15826.1 HIST1H3E isoform 1 [Pongo abelii] >PNJ15827.1 HIST1H3E isoform 2 [Pongo abelii] >PNJ15831.1 HIST1H3F isoform 1 [Pongo abelii] >PNJ15833.1 HIST1H3G isoform 1 [Pongo abelii] >PNJ21120.1 HIST1H3J isoform 2 [Pongo abelii] >PNJ21130.1 HIST1H3H isoform 1 [Pongo abelii])

HSP 1 Score: 249.2 bits (635), Expect = 7.300e-63
Identity = 129/136 (94.85%), Postives = 134/136 (98.53%), Query Frame = 0 
Query:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDVQLARRIRGERA 137
            MARTKQTARKSTGGKAPRKQLATKAARKSAP  GGVKKPHRYRPGTVALREIR+YQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS+A++ALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKD+QLARRIRGERA
Sbjct:    1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA 136
The following BLAST results are available for this feature:
BLAST of NO11G00250 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes)
Total hits: 20
Match NameE-valueIdentityDescription
XP_005855528.15.100e-6499.26histone H3 [Nannochloropsis gaditana CCMP526] >EKU... [more]
EWM25200.15.100e-6499.26histone h3 [Nannochloropsis gaditana][more]
CBN79887.11.100e-6397.79conserved unknown protein [Ectocarpus siliculosus][more]
XP_001419259.12.500e-6397.06predicted protein [Ostreococcus lucimarinus CCE990... [more]
GAX93015.14.300e-6397.78histone H3 [Pythium insidiosum][more]
XP_005843780.15.600e-6396.32hypothetical protein CHLNCDRAFT_59160 [Chlorella v... [more]
3AFA_A7.300e-6394.85Chain A, The Human Nucleosome Structure >3AFA_E Ch... [more]
CCA22507.17.300e-6397.04histone H3.3 type 1 putative [Albugo laibachii Nc1... [more]
XP_527253.27.300e-6394.85histone H3.1-like [Pan troglodytes] >XP_008959258.... [more]
NP_003520.17.300e-6394.85histone H3.1 [Homo sapiens] >NP_003522.1 histone H... [more]

Pages

back to top
Relationships

This gene is member of the following syntenic_region feature(s):

Feature NameUnique NameSpeciesType
nonsL110nonsL110Nannochloropsis oceanica (N. oceanica IMET1)syntenic_region
ncniR067ncniR067Nannochloropsis oceanica (N. oceanica IMET1)syntenic_region
ngnoR018ngnoR018Nannochloropsis oceanica (N. oceanica IMET1)syntenic_region


The following polypeptide feature(s) derives from this gene:

Feature NameUnique NameSpeciesType
NO11G00250.1NO11G00250.1-proteinNannochloropsis oceanica (N. oceanica IMET1)polypeptide


The following gene feature(s) are orthologous to this gene:

Feature NameUnique NameSpeciesType
Naga_100722g1gene5301Nannochloropsis gaditana (N. gaditana B-31)gene


The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
NO11G00250.1NO11G00250.1Nannochloropsis oceanica (N. oceanica IMET1)mRNA


Sequences
The following sequences are available for this feature:

gene sequence

>NO11G00250 ID=NO11G00250|Name=NO11G00250|organism=Nannochloropsis oceanica|type=gene|length=952bp
ATGGCTCGCACCAAGCAGACGGCCCGTAAGTCCACGGGTGGCAAGGCTCC
CCGCAAGCAGCTCGCCACAAAGgtaaggacgagagggagggtaaggaagg
agatgcgcgtacaggaggaccataatcttgtaaccatgcgtatatacctg
tgcagttcgcaccttaatgcaacactccccctttctcccccctccctttt
tcccattccttccttccttccttccttgctccttagGCCGCCCGCAAGTC
GGCGCCCACAGCCGGCGGGGTTAAGAAGCCTCATCGGTACCGCCCCGGCA
CAGTCGCTCTCCGTGAGATCCGCAAATACCAGAAGAGCACAGAGCTCCTC
ATTCGTAAGCTTCCCTTCCAGgtaatgcaagaaaggaagacagcgaggga
gggaggagcgttcgccgcgcactttgttatcgcaagcgctttgtatgctt
acctgtcccccttccctccctcccctcccttccctcccttccctcccttc
cctccctccccttccttcccttcctctcctcctcttccccagCGTCTCGT
CCGTGAAATCGCTCAGGACTTCAAGACCGACCTCCGCTTCCAAAGCACGG
CTATTTTGGCCCTCCAGGAAGCCTGCGAGGCCTACCTTGTCGGCTTGTTC
GAAGATACGgtgcgccactcctccctccctccctccctccctccctccct
ccctcccttcctccttttgggcctttccttgtattttcccccccgtctct
gctcccttctcgttcccttctcgtgccatggagcgctttcgaccaaaccc
tggatatccccccccccttccctccctccctcccccccccctccctccct
ccctccctcccacagAACCTATGTGCGATCCACGCCAAACGCGTGACCAT
CATGCCCAAGGACGTTCAACTCGCCCGTCGCATCCGCGGAGAGCGAGCAT
AA
back to top

protein sequence of NO11G00250.1

>NO11G00250.1-protein ID=NO11G00250.1-protein|Name=NO11G00250.1|organism=Nannochloropsis oceanica|type=polypeptide|length=137bp
MARTKQTARKSTGGKAPRKQLATKAARKSAPTAGGVKKPHRYRPGTVALR
EIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSTAILALQEACEAY
LVGLFEDTNLCAIHAKRVTIMPKDVQLARRIRGERA*
back to top
Synonyms
Publications