NO07G00610, NO07G00610 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO07G00610 vs. NCBI_GenBank
Match: CCA15629.1 (conserved hypothetical protein [Albugo laibachii Nc14] >CCA16311.1 conserved hypothetical protein [Albugo laibachii Nc14]) HSP 1 Score: 95.9 bits (237), Expect = 7.600e-16 Identity = 41/67 (61.19%), Postives = 52/67 (77.61%), Query Frame = 0 Query: 223 KSRRELPNGAVATLKRWLLSPEHFSHPYPSTQDQAQLMAATGIDKKQLKNWFTNARRRIWKPLMKKQ 290 K+RRELP VA LK W+LSPEH HPYP+ D+ L+ TG++ KQL NWFTNAR+RIWKP+M++Q Sbjct: 157 KARRELPPQTVALLKGWMLSPEHIKHPYPTDADKQILLKQTGLNMKQLTNWFTNARKRIWKPMMRQQ 223
BLAST of NO07G00610 vs. NCBI_GenBank
Match: XP_002999175.1 (conserved hypothetical protein [Phytophthora infestans T30-4] >EEY69321.1 conserved hypothetical protein [Phytophthora infestans T30-4]) HSP 1 Score: 95.1 bits (235), Expect = 1.300e-15 Identity = 41/67 (61.19%), Postives = 51/67 (76.12%), Query Frame = 0 Query: 223 KSRRELPNGAVATLKRWLLSPEHFSHPYPSTQDQAQLMAATGIDKKQLKNWFTNARRRIWKPLMKKQ 290 KSRRELP VA LK W+LS EH HPYP+ +D+ L+ TGI KQL NWFTNAR+RIWKP+M+++ Sbjct: 100 KSRRELPPHTVAILKGWMLSREHVKHPYPTDEDKQMLLKKTGISMKQLTNWFTNARKRIWKPMMRRE 166
BLAST of NO07G00610 vs. NCBI_GenBank
Match: XP_024584603.1 (bel1 homeotic [Plasmopara halstedii] >CEG48234.1 bel1 homeotic [Plasmopara halstedii]) HSP 1 Score: 95.1 bits (235), Expect = 1.300e-15 Identity = 41/67 (61.19%), Postives = 51/67 (76.12%), Query Frame = 0 Query: 223 KSRRELPNGAVATLKRWLLSPEHFSHPYPSTQDQAQLMAATGIDKKQLKNWFTNARRRIWKPLMKKQ 290 KSRRELP VA LK W+LS EH HPYP+ +D+ L+ TGI KQL NWFTNAR+RIWKP+M+++ Sbjct: 96 KSRRELPPHTVAILKGWMLSREHVKHPYPTDEDKQMLLKKTGISMKQLTNWFTNARKRIWKPMMRRE 162
BLAST of NO07G00610 vs. NCBI_GenBank
Match: OWZ24631.1 (Homebox and aldo/keto reductase [Phytophthora megakarya]) HSP 1 Score: 95.1 bits (235), Expect = 1.300e-15 Identity = 41/67 (61.19%), Postives = 51/67 (76.12%), Query Frame = 0 Query: 223 KSRRELPNGAVATLKRWLLSPEHFSHPYPSTQDQAQLMAATGIDKKQLKNWFTNARRRIWKPLMKKQ 290 KSRRELP VA LK W+LS EH HPYP+ +D+ L+ TGI KQL NWFTNAR+RIWKP+M+++ Sbjct: 78 KSRRELPPHTVAILKGWMLSREHVKHPYPTDEDKQMLLKKTGISMKQLTNWFTNARKRIWKPMMRRE 144
BLAST of NO07G00610 vs. NCBI_GenBank
Match: POM63718.1 (Homebox domain containing hypothetical protein [Phytophthora palmivora var. palmivora]) HSP 1 Score: 95.1 bits (235), Expect = 1.300e-15 Identity = 41/67 (61.19%), Postives = 51/67 (76.12%), Query Frame = 0 Query: 223 KSRRELPNGAVATLKRWLLSPEHFSHPYPSTQDQAQLMAATGIDKKQLKNWFTNARRRIWKPLMKKQ 290 KSRRELP VA LK W+LS EH HPYP+ +D+ L+ TGI KQL NWFTNAR+RIWKP+M+++ Sbjct: 86 KSRRELPPHTVAILKGWMLSREHVKHPYPTDEDKQMLLKKTGISMKQLTNWFTNARKRIWKPMMRRE 152
BLAST of NO07G00610 vs. NCBI_GenBank
Match: XP_009827735.1 (hypothetical protein H257_04805 [Aphanomyces astaci] >ETV83064.1 hypothetical protein H257_04805 [Aphanomyces astaci]) HSP 1 Score: 93.2 bits (230), Expect = 4.900e-15 Identity = 39/67 (58.21%), Postives = 50/67 (74.63%), Query Frame = 0 Query: 223 KSRRELPNGAVATLKRWLLSPEHFSHPYPSTQDQAQLMAATGIDKKQLKNWFTNARRRIWKPLMKKQ 290 K RRELP V LK W+LS EH HPYP+ D+ +L+ TGI+ KQL NWFTNAR+RIWKP+M+++ Sbjct: 98 KPRRELPPATVKILKDWMLSTEHIKHPYPTDDDKKKLLETTGINMKQLTNWFTNARKRIWKPMMRRE 164
BLAST of NO07G00610 vs. NCBI_GenBank
Match: XP_008861912.1 (hypothetical protein H310_00791 [Aphanomyces invadans] >ETW10501.1 hypothetical protein H310_00791 [Aphanomyces invadans]) HSP 1 Score: 91.3 bits (225), Expect = 1.900e-14 Identity = 38/67 (56.72%), Postives = 50/67 (74.63%), Query Frame = 0 Query: 223 KSRRELPNGAVATLKRWLLSPEHFSHPYPSTQDQAQLMAATGIDKKQLKNWFTNARRRIWKPLMKKQ 290 K RRELP V LK W+LS EH HPYP+ D+ +L+ TGI+ KQL NWFTNAR+RIWKP+++++ Sbjct: 91 KPRRELPPATVKILKDWMLSSEHIKHPYPTDDDKKKLLELTGINMKQLTNWFTNARKRIWKPMIRRE 157
BLAST of NO07G00610 vs. NCBI_GenBank
Match: GAX96280.1 (homebox domain-containing protein [Pythium insidiosum]) HSP 1 Score: 89.7 bits (221), Expect = 5.400e-14 Identity = 37/62 (59.68%), Postives = 48/62 (77.42%), Query Frame = 0 Query: 228 LPNGAVATLKRWLLSPEHFSHPYPSTQDQAQLMAATGIDKKQLKNWFTNARRRIWKPLMKKQ 290 LP VA LK W+LSPEH HPYP+ +D+ L+ TGI+ KQL NWFTNAR+RIWKP+M+++ Sbjct: 114 LPPHTVAILKGWMLSPEHVKHPYPTDEDKQMLLKKTGINMKQLTNWFTNARKRIWKPMMRRE 175
BLAST of NO07G00610 vs. NCBI_GenBank
Match: GAX93422.1 (homebox domain-containing protein [Pythium insidiosum]) HSP 1 Score: 89.7 bits (221), Expect = 5.400e-14 Identity = 37/62 (59.68%), Postives = 48/62 (77.42%), Query Frame = 0 Query: 228 LPNGAVATLKRWLLSPEHFSHPYPSTQDQAQLMAATGIDKKQLKNWFTNARRRIWKPLMKKQ 290 LP VA LK W+LSPEH HPYP+ +D+ L+ TGI+ KQL NWFTNAR+RIWKP+M+++ Sbjct: 91 LPPHTVAILKGWMLSPEHVKHPYPTDEDKQMLLKKTGINMKQLTNWFTNARKRIWKPMMRRE 152
BLAST of NO07G00610 vs. NCBI_GenBank
Match: XP_009519001.1 (homebox domain-containing protein [Phytophthora sojae] >EGZ23713.1 homebox domain-containing protein [Phytophthora sojae]) HSP 1 Score: 87.8 bits (216), Expect = 2.100e-13 Identity = 37/63 (58.73%), Postives = 47/63 (74.60%), Query Frame = 0 Query: 227 ELPNGAVATLKRWLLSPEHFSHPYPSTQDQAQLMAATGIDKKQLKNWFTNARRRIWKPLMKKQ 290 ELP VA LK W+LS EH HPYP+ +D+ L+ TGI KQL NWFTNAR+RIWKP+M+++ Sbjct: 80 ELPPHTVAILKGWMLSREHVKHPYPTDEDKQMLLKKTGISMKQLTNWFTNARKRIWKPMMRRE 142 The following BLAST results are available for this feature:
BLAST of NO07G00610 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 20
Pagesback to topRelationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO07G00610 ID=NO07G00610|Name=NO07G00610|organism=Nannochloropsis oceanica|type=gene|length=5118bpback to top protein sequence of NO07G00610.1 >NO07G00610.1-protein ID=NO07G00610.1-protein|Name=NO07G00610.1|organism=Nannochloropsis oceanica|type=polypeptide|length=1000bpback to top Synonyms
Publications
|