NO02G05340, NO02G05340 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO02G05340 vs. NCBI_GenBank
Match: OIW28303.1 (U-box-domain-containing protein [Coniochaeta ligniaria NRRL 30616]) HSP 1 Score: 70.1 bits (170), Expect = 2.200e-8 Identity = 35/71 (49.30%), Postives = 48/71 (67.61%), Query Frame = 0 Query: 378 AADAYDEDDDAPEPFLDPLTMEVMVDPALTPSGYSYERAVIVEQIRRRGVDPMTQQPLAEEDLRPNRALRE 449 A A D P +D ++ EVMVDP +T +G SYERA I+E +RR+ DP+T++PL+ DLRPN AL+E Sbjct: 11 ARSAEDRRRTVPGWAIDDISFEVMVDPVITKTGKSYERASIMEHLRRKPTDPLTREPLSIADLRPNLALKE 81
BLAST of NO02G05340 vs. NCBI_GenBank
Match: KKP07381.1 (STIP1 likey and U-box containing protein 1 [Trichoderma harzianum]) HSP 1 Score: 69.7 bits (169), Expect = 2.800e-8 Identity = 30/62 (48.39%), Postives = 46/62 (74.19%), Query Frame = 0 Query: 387 DAPEPFLDPLTMEVMVDPALTPSGYSYERAVIVEQIRRRGVDPMTQQPLAEEDLRPNRALRE 449 + P+ +D ++ ++MVDP +T +G SYERA I+E +RR DP+T++PL+ DLRPN ALR+ Sbjct: 194 EVPDWAIDDISFDIMVDPVITKTGKSYERATIMEHLRRHPSDPLTREPLSASDLRPNLALRQ 255
BLAST of NO02G05340 vs. NCBI_GenBank
Match: OPB47169.1 (hypothetical protein A0O28_0072930 [Trichoderma guizhouense]) HSP 1 Score: 69.7 bits (169), Expect = 2.800e-8 Identity = 30/62 (48.39%), Postives = 46/62 (74.19%), Query Frame = 0 Query: 387 DAPEPFLDPLTMEVMVDPALTPSGYSYERAVIVEQIRRRGVDPMTQQPLAEEDLRPNRALRE 449 + P+ +D ++ ++MVDP +T +G SYERA I+E +RR DP+T++PL+ DLRPN ALR+ Sbjct: 194 EVPDWAIDDISFDIMVDPVITKTGKSYERATIMEHLRRHPSDPLTREPLSASDLRPNLALRQ 255
BLAST of NO02G05340 vs. NCBI_GenBank
Match: XP_002549596.1 (predicted protein [Candida tropicalis MYA-3404] >EER32222.1 predicted protein [Candida tropicalis MYA-3404]) HSP 1 Score: 69.3 bits (168), Expect = 3.700e-8 Identity = 30/73 (41.10%), Postives = 52/73 (71.23%), Query Frame = 0 Query: 383 DEDDDAPEPFLDPLTMEVMVDPALTPSGYSYERAVIVEQIRRRG-VDPMTQQPLAEEDLRPNRALREMIGLWR 455 D+D++APE LDP++ E+ DP +TPSG +YE++ +++ ++ RG DP+T+Q L E+ L PN +++ I +R Sbjct: 157 DDDEEAPEYLLDPISFELFTDPVITPSGITYEKSHLLDHLKNRGKFDPITRQELTEDQLYPNLIMKDTIEAYR 229
BLAST of NO02G05340 vs. NCBI_GenBank
Match: XP_013952206.1 (hypothetical protein TRIVIDRAFT_159562 [Trichoderma virens Gv29-8] >EHK18006.1 hypothetical protein TRIVIDRAFT_159562 [Trichoderma virens Gv29-8]) HSP 1 Score: 69.3 bits (168), Expect = 3.700e-8 Identity = 30/62 (48.39%), Postives = 46/62 (74.19%), Query Frame = 0 Query: 387 DAPEPFLDPLTMEVMVDPALTPSGYSYERAVIVEQIRRRGVDPMTQQPLAEEDLRPNRALRE 449 + P+ +D ++ ++MVDP +T +G SYERA I+E +RR DP+T++PL+ DLRPN ALR+ Sbjct: 194 EVPDWAIDDISFDIMVDPVITKTGKSYERATIMEHLRRHPSDPLTREPLSAADLRPNLALRQ 255
BLAST of NO02G05340 vs. NCBI_GenBank
Match: XP_013331085.1 (U-box domain protein [Rasamsonia emersonii CBS 393.64] >KKA24473.1 U-box domain protein [Rasamsonia emersonii CBS 393.64]) HSP 1 Score: 69.3 bits (168), Expect = 3.700e-8 Identity = 31/60 (51.67%), Postives = 44/60 (73.33%), Query Frame = 0 Query: 389 PEPFLDPLTMEVMVDPALTPSGYSYERAVIVEQIRRRGVDPMTQQPLAEEDLRPNRALRE 449 P+ +D ++ EVM DP +TPSG+S++R IV I R GVDP+T+ P+ +DLRPN AL+E Sbjct: 210 PDYLIDGISFEVMHDPVITPSGHSFDRVNIVRHIERAGVDPITRVPMTVDDLRPNYALKE 269
BLAST of NO02G05340 vs. NCBI_GenBank
Match: XP_018034268.1 (U-box-domain-containing protein [Paraphaeosphaeria sporulosa] >OAG03903.1 U-box-domain-containing protein [Paraphaeosphaeria sporulosa]) HSP 1 Score: 69.3 bits (168), Expect = 3.700e-8 Identity = 30/62 (48.39%), Postives = 44/62 (70.97%), Query Frame = 0 Query: 387 DAPEPFLDPLTMEVMVDPALTPSGYSYERAVIVEQIRRRGVDPMTQQPLAEEDLRPNRALRE 449 + P+ +D +T EVM DP +T +G SYERA I+E ++R DP+T++PL +LRPN AL+E Sbjct: 214 EVPDYLIDGITFEVMTDPVVTKNGRSYERATIIEHLKRSATDPLTREPLTINELRPNIALKE 275
BLAST of NO02G05340 vs. NCBI_GenBank
Match: PNP55506.1 (hypothetical protein THARTR1_04336 [Trichoderma harzianum]) HSP 1 Score: 69.3 bits (168), Expect = 3.700e-8 Identity = 30/62 (48.39%), Postives = 46/62 (74.19%), Query Frame = 0 Query: 387 DAPEPFLDPLTMEVMVDPALTPSGYSYERAVIVEQIRRRGVDPMTQQPLAEEDLRPNRALRE 449 + P+ +D ++ ++MVDP +T +G SYERA I+E +RR DP+T++PL+ DLRPN ALR+ Sbjct: 149 EVPDWAIDDISFDIMVDPVITKTGKSYERATIMEHLRRHPSDPLTREPLSAADLRPNLALRQ 210
BLAST of NO02G05340 vs. NCBI_GenBank
Match: EPS28130.1 (hypothetical protein PDE_03076 [Penicillium oxalicum 114-2]) HSP 1 Score: 68.9 bits (167), Expect = 4.800e-8 Identity = 30/59 (50.85%), Postives = 45/59 (76.27%), Query Frame = 0 Query: 389 PEPFLDPLTMEVMVDPALTPSGYSYERAVIVEQIRRRGVDPMTQQPLAEEDLRPNRALR 448 P+ +D +T E+M DP +TPSG S++RA IV+ I + GVDP+T++P+ +DLRPN AL+ Sbjct: 210 PDYLIDGITFEIMHDPVMTPSGTSFDRAGIVKYIEKSGVDPLTREPMTVKDLRPNYALK 268
BLAST of NO02G05340 vs. NCBI_GenBank
Match: CEJ81436.1 (hypothetical protein VHEMI01558 [Torrubiella hemipterigena]) HSP 1 Score: 68.9 bits (167), Expect = 4.800e-8 Identity = 32/61 (52.46%), Postives = 43/61 (70.49%), Query Frame = 0 Query: 387 DAPEPFLDPLTMEVMVDPALTPSGYSYERAVIVEQIRRRGVDPMTQQPLAEEDLRPNRALR 448 + P+ +D ++ VMVDP +T +G SYERA I E +RR DP+T++PL EDLRPN ALR Sbjct: 196 EVPDWLIDDISFGVMVDPVITKTGKSYERASITEHLRRHPSDPLTREPLTMEDLRPNMALR 256 The following BLAST results are available for this feature:
BLAST of NO02G05340 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 20
Pagesback to topRelationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO02G05340 ID=NO02G05340|Name=NO02G05340|organism=Nannochloropsis oceanica|type=gene|length=1467bpback to top protein sequence of NO02G05340.1 >NO02G05340.1-protein ID=NO02G05340.1-protein|Name=NO02G05340.1|organism=Nannochloropsis oceanica|type=polypeptide|length=489bpback to top Synonyms
Publications
|