jgi.p|Nanoce1779_2|576092, gene_66 (gene) Nannochloropsis oceanica | NanDeSyn: Nannochloropsis Design & Synthesis Initiative

Overview


Name	jgi.p\|Nanoce1779_2\|576092
Unique Name	gene_66
Type	gene
Organism	Nannochloropsis oceanica (N. oceanica CCMP1779)
Alignment location	scaffold_3:179878..180753 -

Link to JBrowse

Properties


Property Name	Value
TranscriptId	576178
ProteinId	576092
Product name	H -or Na -translocating f-type, v-type and A-type ATPase superfamily
Portal id	Nanoce1779_2

Mutants

Expression

Analysis:

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Alignments

The following features are aligned


Aligned Feature	Feature Type	Alignment Location
scaffold_3	supercontig	scaffold_3:179878..180753 -

Analyses

This gene is derived from or has results from the following analyses


Analysis Name	Date Performed
GSE164714	2022-03-15
GO annotation for N. oceanica CCMP1779 v2	2020-03-30
PRJNA285666	2019-07-03
PRJNA157867	2019-07-02
Gene prediction for N. oceanica CCMP1779	2008-02-01

Annotated Terms

The following terms have been associated with this gene:

Vocabulary: **Cellular Component**
Term	Definition
GO:0005739	mitochondrion
GO:0016469	proton-transporting two-sector ATPase complex

Vocabulary: **Biological Process**
Term	Definition
GO:0015986	ATP synthesis coupled proton transport

Vocabulary: **Molecular Function**
Term	Definition
GO:0046933	proton-transporting ATP synthase activity, rotational mechanism
GO:0046961	proton-transporting ATPase activity, rotational mechanism

Homology

Relationships

This gene is member of the following syntenic_region feature(s):


Feature Name	Unique Name	Species	Type
ncniL047	ncniL047	Nannochloropsis oceanica (N. oceanica CCMP1779)	syntenic_region

This gene is orthologous to the following gene feature(s):


Feature Name	Unique Name	Species	Type
NO01G00920	NO01G00920	Nannochloropsis oceanica (N. oceanica IMET1)	gene

The following polypeptide feature(s) derives from this gene:


Feature Name	Unique Name	Species	Type
jgi.p\|Nanoce1779_2\|576092	mRNA_66-protein	Nannochloropsis oceanica (N. oceanica CCMP1779)	polypeptide

The following mRNA feature(s) are a part of this gene:


Feature Name	Unique Name	Species	Type
jgi.p\|Nanoce1779_2\|576092	mRNA_66	Nannochloropsis oceanica (N. oceanica CCMP1779)	mRNA

Sequences

The following sequences are available for this feature:

protein sequence

protein sequence of jgi.p|Nanoce1779_2|576092

>mRNA_66-protein ID=mRNA_66-protein|Name=jgi.p|Nanoce1779_2|576092|organism=Nannochloropsis oceanica|type=polypeptide|length=72bp
MSAAAATTYWRIAGLTYLQYTSKAAGVLRAALKEPLRTKTMAKEKIYYKK
LPWTPKLIGQPVGPLKVEVTSL

Synonyms

Publications