NO26G00690, NO26G00690 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO26G00690 vs. NCBI_GenBank
Match: CEL97128.1 (unnamed protein product [Vitrella brassicaformis CCMP3155]) HSP 1 Score: 66.6 bits (161), Expect = 4.700e-8 Identity = 36/81 (44.44%), Postives = 50/81 (61.73%), Query Frame = 0 Query: 4 PLLVTSVETARGLDFAGECDCVLILGRAKSADEYQHVAGRTGRRGRDGGREVMEGEGGSAVSVISYVDIKKLTGYESMLGI 85 PLLV S++ ARGL F + D V +LGR ++ DEYQH+AGRTGR +G GG+AV + +++ L + MLGI Sbjct: 380 PLLVASMDGARGLHF-NQVDMVFVLGRPRTPDEYQHLAGRTGR----------QGAGGTAVIIGDSFEVRSLLAWRKMLGI 449
BLAST of NO26G00690 vs. NCBI_GenBank
Match: PHJ19175.1 (dead deah box helicase domain-containing protein, partial [Cystoisospora suis]) HSP 1 Score: 64.3 bits (155), Expect = 2.300e-7 Identity = 39/89 (43.82%), Postives = 51/89 (57.30%), Query Frame = 0 Query: 5 LLVTSVETARGLDFAGECDCVLILGRAKSADEYQHVAGRTGRRGRDGGREVMEGEGGSAVSVISYVDIKKLTGYESMLGIKFTRENGLI 94 LLVTS++TARGL F + D V ++GR +SADEYQH+AGRTGR G+ G A+ V + L +E ML I F L+ Sbjct: 794 LLVTSMDTARGLHF-DDIDVVFLVGRVESADEYQHLAGRTGRGGKP----------GIAICVSDADTQRLLRSWEKMLDISFRPTTDLL 871 The following BLAST results are available for this feature:
BLAST of NO26G00690 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 2
Relationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO26G00690 ID=NO26G00690|Name=NO26G00690|organism=Nannochloropsis oceanica|type=gene|length=288bpback to top protein sequence of NO26G00690.1 >NO26G00690.1-protein ID=NO26G00690.1-protein|Name=NO26G00690.1|organism=Nannochloropsis oceanica|type=polypeptide|length=96bpback to top Synonyms
Publications
|