NO25G00400, NO25G00400 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO25G00400 vs. NCBI_GenBank
Match: XP_005852601.1 (hypothetical protein NGA_0712000 [Nannochloropsis gaditana CCMP526] >EKU23232.1 hypothetical protein NGA_0712000 [Nannochloropsis gaditana CCMP526] >EWM21558.1 Golgi apparatus membrane protein TVP15 [Nannochloropsis gaditana]) HSP 1 Score: 205.3 bits (521), Expect = 1.200e-49 Identity = 94/128 (73.44%), Postives = 112/128 (87.50%), Query Frame = 0 Query: 4 KTVPSITVRLYCLFFLVIIILSELEWSKPVRDSAITTSWFWRGVFQIFVAALVYEMKPQGSSVTEAEQNFIIFTSLVLLVIGFLYAGMGLCFVKRWRDSNLAKYRTMRAHAEMADELQGDPSLAPPPR 132 +T+P TVRLYCLFFL++I+LSE+EWSKPVRDSAITTSWFWRG FQ+FVAALVYEM+P G +++ ++NFI F ++VLLV+GFLYA MGLCFVKRWRD+ LAKYRTMRAHAEMAD LQ D SLA P+ Sbjct: 61 RTLPGFTVRLYCLFFLLVIVLSEIEWSKPVRDSAITTSWFWRGAFQVFVAALVYEMQPGGDNLSAVKRNFIAFAAIVLLVVGFLYAAMGLCFVKRWRDTQLAKYRTMRAHAEMADALQNDASLAGSPQ 188
BLAST of NO25G00400 vs. NCBI_GenBank
Match: CBN77586.1 (conserved unknown protein [Ectocarpus siliculosus]) HSP 1 Score: 83.2 bits (204), Expect = 6.700e-13 Identity = 44/116 (37.93%), Postives = 68/116 (58.62%), Query Frame = 0 Query: 8 SITVRLYCLFFLVIIILSELEWSKPVRDSAITTSWFWRGVFQIFVAALVYEMKPQGSSVTEAEQNFIIFTSLVLLVIGFLYAGMGLCFVKRWRDSNLAKYRTMRAHAEMADELQGD 124 S+ VR Y + F ++II++ELEW+ VR+ + SW RGV FV LV E + + +I + +++ IG LY +GLC VKR RD +A+++T+ AHAEM ++ D Sbjct: 51 SVAVRCYNILFCMLIIMAELEWTTTVREMFVLHSWIPRGVVYSFVGVLVLEEEDEKGLDLGGFGLYITIIAWIMVGIGALYFLLGLCCVKRIRDKKMARHKTLVAHAEMQAAMRRD 166 The following BLAST results are available for this feature:
BLAST of NO25G00400 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 2
Relationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO25G00400 ID=NO25G00400|Name=NO25G00400|organism=Nannochloropsis oceanica|type=gene|length=1542bpback to top protein sequence of NO25G00400.1 >NO25G00400.1-protein ID=NO25G00400.1-protein|Name=NO25G00400.1|organism=Nannochloropsis oceanica|type=polypeptide|length=190bpback to top protein sequence of NO25G00400.2 >NO25G00400.2-protein ID=NO25G00400.2-protein|Name=NO25G00400.2|organism=Nannochloropsis oceanica|type=polypeptide|length=133bpback to top Synonyms
Publications
|