NO18G00900, NO18G00900 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO18G00900 vs. NCBI_GenBank
Match: XP_005853993.1 (cytochrome c oxidase assembly mitochondrial [Nannochloropsis gaditana CCMP526] >XP_005854903.1 cytochrome c oxidase assembly mitochondrial [Nannochloropsis gaditana CCMP526] >EKU21447.1 cytochrome c oxidase assembly mitochondrial [Nannochloropsis gaditana CCMP526] >EKU22362.1 cytochrome c oxidase assembly mitochondrial [Nannochloropsis gaditana CCMP526] >EWM23290.1 Cytochrome c oxidase assembly protein PET191 [Nannochloropsis gaditana]) HSP 1 Score: 128.3 bits (321), Expect = 9.300e-27 Identity = 61/67 (91.04%), Postives = 63/67 (94.03%), Query Frame = 0 Query: 1 MPKSCKEAAYALLACMQQQPCMKSGVALKECLKGEDVDACMVQRNAYFLCKRSQLDMRTRIRGTRVY 68 MPKSCKEAAYALLACMQQQPCMK+G +L ECLK EDVDAC VQRNAYFLCKRSQLDMRTRIRGTRVY Sbjct: 1 MPKSCKEAAYALLACMQQQPCMKTGGSLTECLKSEDVDACSVQRNAYFLCKRSQLDMRTRIRGTRVY 67
BLAST of NO18G00900 vs. NCBI_GenBank
Match: CBJ32736.1 (expressed unknown protein [Ectocarpus siliculosus]) HSP 1 Score: 77.4 bits (189), Expect = 1.900e-11 Identity = 37/67 (55.22%), Postives = 45/67 (67.16%), Query Frame = 0 Query: 1 MPKSCKEAAYALLACMQQQPCMKSGVALKECLKGEDVDACMVQRNAYFLCKRSQLDMRTRIRGTRVY 68 M + CKEAA AL ACM++ CMK G LK+CLK D + C ++F CKR QLDMRTRIRG R + Sbjct: 1 MGRDCKEAARALYACMKKTQCMKDGGRLKDCLKTSDREFCRQDHQSFFECKRGQLDMRTRIRGERSF 67
BLAST of NO18G00900 vs. NCBI_GenBank
Match: OEU20330.1 (hypothetical protein FRACYDRAFT_168006 [Fragilariopsis cylindrus CCMP1102]) HSP 1 Score: 75.1 bits (183), Expect = 9.400e-11 Identity = 38/73 (52.05%), Postives = 49/73 (67.12%), Query Frame = 0 Query: 1 MPKSCKEAAYALLACMQQQPCMKSGV-ALKECLKGEDVD-----ACMVQRNAYFLCKRSQLDMRTRIRGTRVY 68 MPK+C EAA +LL CM++ C K ++ +CLK ++ D C QR AY+LCK SQL+MRTRIRGTR Y Sbjct: 1 MPKACSEAALSLLTCMEESKCFKEDKHSVYDCLKKQNDDPIAAEECKAQRTAYYLCKHSQLNMRTRIRGTRAY 73
BLAST of NO18G00900 vs. NCBI_GenBank
Match: GAX17823.1 (hypothetical protein FisN_18Hu023 [Fistulifera solaris]) HSP 1 Score: 70.5 bits (171), Expect = 2.300e-9 Identity = 35/69 (50.72%), Postives = 48/69 (69.57%), Query Frame = 0 Query: 1 MPKSCKEAAYALLACMQQQPC-MKSGVALKECLKGE-DVDACMVQRNAYFLCKRSQLDMRTRIRGTRVY 68 MP SC EAA++LL CM++ PC ++ ++ +CL+ + D C RNAY +CK SQL+MRTRIRG R Y Sbjct: 1 MPHSCNEAAFSLLQCMEETPCVVEEKRSVYDCLQDPYESDPCRAFRNAYTMCKHSQLNMRTRIRGVRTY 69
BLAST of NO18G00900 vs. NCBI_GenBank
Match: CCA28364.1 (hypothetical protein PITG_00849 [Albugo laibachii Nc14]) HSP 1 Score: 62.4 bits (150), Expect = 6.300e-7 Identity = 35/67 (52.24%), Postives = 43/67 (64.18%), Query Frame = 0 Query: 1 MPKSCKEAAYALLACMQQQPCMKSGV-ALKECL-KGEDVDACMVQRNAYFLCKRSQLDMRTRIRGTR 66 M KSC++ A AL CM +Q CM +G L+ECL + + D C R AYF CKR QLDMRTR RG + Sbjct: 24 MGKSCRDMAQALRDCMIKQECMSTGERTLQECLHERKYADECHAYRVAYFECKRGQLDMRTRFRGPK 90 The following BLAST results are available for this feature:
BLAST of NO18G00900 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 5
Relationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO18G00900 ID=NO18G00900|Name=NO18G00900|organism=Nannochloropsis oceanica|type=gene|length=1051bpback to top protein sequence of NO18G00900.1 >NO18G00900.1-protein ID=NO18G00900.1-protein|Name=NO18G00900.1|organism=Nannochloropsis oceanica|type=polypeptide|length=68bpback to top Synonyms
Publications
|