NO17G01060, NO17G01060 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO17G01060 vs. NCBI_GenBank
Match: XP_012209503.1 (hypothetical protein SPRG_14989 [Saprolegnia parasitica CBS 223.65] >KDO19795.1 hypothetical protein SPRG_14989 [Saprolegnia parasitica CBS 223.65]) HSP 1 Score: 66.6 bits (161), Expect = 6.000e-8 Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 0 Query: 43 IWLGGWVLVLGSLLFLSFFLYSIVLAKLLPMRPSDGGKIRRWMDLVRDDEYFCLLVPLTLAPATVLGYLNWVAIEFYRAN 123 IW G+V+V S F FLY IV+AKLLP PSD M+ +R D ++C L+PLT+ + Y+NWV+++++R N Sbjct: 24 IW--GYVIVGLSFAFFMTFLYLIVVAKLLP--PSDDPSRFPMMETIRQDHFYCYLIPLTIPAGFIAMYINWVSLKYFRHN 99
BLAST of NO17G01060 vs. NCBI_GenBank
Match: XP_009842553.1 (hypothetical protein H257_15954 [Aphanomyces astaci] >ETV67990.1 hypothetical protein H257_15954 [Aphanomyces astaci]) HSP 1 Score: 66.2 bits (160), Expect = 7.900e-8 Identity = 33/80 (41.25%), Postives = 53/80 (66.25%), Query Frame = 0 Query: 43 IWLGGWVLVLGSLLFLSFFLYSIVLAKLLPMRPSDGGKIRRWMDLVRDDEYFCLLVPLTLAPATVLGYLNWVAIEFYRAN 123 IW G+V+V S +F F+Y IV+AK+LP P G+ MD +R D+++C LVPLT+ A + Y++WV+++++R N Sbjct: 14 IW--GYVIVSLSAIFFITFMYLIVVAKVLP--PPTPGRSFPMMDAIRGDQHYCYLVPLTIPVAFIAMYVSWVSLKYFRQN 89
BLAST of NO17G01060 vs. NCBI_GenBank
Match: XP_012210666.1 (hypothetical protein SPRG_16050 [Saprolegnia parasitica CBS 223.65] >KDO18620.1 hypothetical protein SPRG_16050 [Saprolegnia parasitica CBS 223.65]) HSP 1 Score: 66.2 bits (160), Expect = 7.900e-8 Identity = 34/80 (42.50%), Postives = 50/80 (62.50%), Query Frame = 0 Query: 43 IWLGGWVLVLGSLLFLSFFLYSIVLAKLLPMRPSDGGKIRRWMDLVRDDEYFCLLVPLTLAPATVLGYLNWVAIEFYRAN 123 IW G+V+V S F FLY IV+AKLLP PSD M+ +R D ++C L+PLT+ + Y+NWV+++++R N Sbjct: 24 IW--GYVIVGLSFAFFMTFLYLIVVAKLLP--PSDDPARFPMMETIRQDHFYCYLIPLTIPAGFIAMYINWVSLKYFRHN 99 The following BLAST results are available for this feature:
BLAST of NO17G01060 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 3
Relationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO17G01060 ID=NO17G01060|Name=NO17G01060|organism=Nannochloropsis oceanica|type=gene|length=1189bpback to top protein sequence of NO17G01060.1 >NO17G01060.1-protein ID=NO17G01060.1-protein|Name=NO17G01060.1|organism=Nannochloropsis oceanica|type=polypeptide|length=123bpback to top Synonyms
Publications
|