NO16G02890, NO16G02890 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO16G02890 vs. NCBI_GenBank
Match: XP_004997530.1 (Kifc3 protein [Salpingoeca rosetta] >EGD80969.1 Kifc3 protein [Salpingoeca rosetta]) HSP 1 Score: 77.8 bits (190), Expect = 7.900e-11 Identity = 41/112 (36.61%), Postives = 61/112 (54.46%), Query Frame = 0 Query: 249 FKKADFDKNGILSHHEFMAFVRG--LRLGLNEKEVEQFTSLADSNGDGMVEWTEVLELTPLILRKLYTALPPGPHDWCAIIDAEE-NEYYLNKRTGLTVSTRPPDYVPVRTE 358 F+ AD D NG+L EF + + L+L L++ E+EQ AD +GDG + + E + + +L +Y +DWC + D + N YYLNKRTG T RP ++ R E Sbjct: 43 FQNADADNNGVLDVDEFESVLSSDTLKLNLSKDEMEQIRRSADQDGDGKISYEEFIPVFKEVLTVIYQEKEEDWNDWCQLRDPRDGNVYYLNKRTGATQVERPHNFHEERVE 154
BLAST of NO16G02890 vs. NCBI_GenBank
Match: XP_001746591.1 (hypothetical protein, partial [Monosiga brevicollis MX1] >EDQ88487.1 predicted protein, partial [Monosiga brevicollis MX1]) HSP 1 Score: 71.6 bits (174), Expect = 5.600e-9 Identity = 40/112 (35.71%), Postives = 57/112 (50.89%), Query Frame = 0 Query: 249 FKKADFDKNGILSHHEFMAFVRG--LRLGLNEKEVEQFTSLADSNGDGMVEWTEVLELTPLILRKLYTALPPGPHDWCAIIDAEE-NEYYLNKRTGLTVSTRPPDYVPVRTE 358 F+ AD D NG L EF + L L L++ EV + AD++ DG++ + E + + +LR +Y +DW + D E N +YLNKRTG T RP Y R E Sbjct: 73 FRAADKDGNGSLDAQEFWNVLHSQTLNLNLSDSEVNELRDAADTDKDGVISYEEFIPVVKELLRTIYARKDDDWNDWSCLTDPETGNTFYLNKRTGETSRRRPTLYHEERRE 184 The following BLAST results are available for this feature:
BLAST of NO16G02890 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 2
Relationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO16G02890 ID=NO16G02890|Name=NO16G02890|organism=Nannochloropsis oceanica|type=gene|length=1331bpback to top protein sequence of NO16G02890.1 >NO16G02890.1-protein ID=NO16G02890.1-protein|Name=NO16G02890.1|organism=Nannochloropsis oceanica|type=polypeptide|length=369bpback to top Synonyms
Publications
|