NO11G02890, NO11G02890 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO11G02890 vs. NCBI_GenBank
Match: EWM24926.1 (eukaryotic translation initiation factor 2-alpha kinase 4 [Nannochloropsis gaditana]) HSP 1 Score: 150.6 bits (379), Expect = 5.600e-33 Identity = 74/107 (69.16%), Postives = 91/107 (85.05%), Query Frame = 0 Query: 54 VILSCLDTKHTQHAAG-DRRKAFKEMAALERRVRAHIQGMVGHPFAGSGPQREPVVVLAMEVPYMVIRMFCTAYLRLGAEEALRDPWVSQQGGAHKRSMKLLGEALE 160 V LS LD+K +Q+A G DRRKA+KEM ALERRVR+H++ MVGHPF GSGPQRE VVVLA+E+PY+VIR+FCTAYLR+G EEALRDPWVSQ G +K+ ++ L +ALE Sbjct: 1288 VKLSYLDSKLSQYAPGADRRKAYKEMTALERRVRSHLERMVGHPFVGSGPQREAVVVLAVEMPYIVIRVFCTAYLRVGPEEALRDPWVSQHCGPYKKGLRSLADALE 1394 The following BLAST results are available for this feature:
BLAST of NO11G02890 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 1
Relationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO11G02890 ID=NO11G02890|Name=NO11G02890|organism=Nannochloropsis oceanica|type=gene|length=654bpback to top protein sequence of NO11G02890.1 >NO11G02890.1-protein ID=NO11G02890.1-protein|Name=NO11G02890.1|organism=Nannochloropsis oceanica|type=polypeptide|length=218bpback to top Synonyms
Publications
|