NO11G02510, NO11G02510 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
Homology
BLAST of NO11G02510 vs. NCBI_GenBank
Match: XP_005855253.1 (hypothetical protein NGA_0082200, partial [Nannochloropsis gaditana CCMP526] >EKU21110.1 hypothetical protein NGA_0082200, partial [Nannochloropsis gaditana CCMP526]) HSP 1 Score: 139.0 bits (349), Expect = 7.800e-30 Identity = 63/78 (80.77%), Postives = 73/78 (93.59%), Query Frame = 0 Query: 1 MTTTRLVRPPRLLGFGGRPYNFFERDALPQNLSSVLKGKFAAVLMVEGALIFGDDQGHITFTDADLRLSLQHRILSPP 79 M++++LVRPPRLLGFGGRPYNFF+RD+LP+NLSSVLKG A+ L+VEGALIF DDQGHITFTDADL +SLQHRILSPP Sbjct: 1 MSSSKLVRPPRLLGFGGRPYNFFDRDSLPRNLSSVLKGNLASALLVEGALIFADDQGHITFTDADLHVSLQHRILSPP 78
BLAST of NO11G02510 vs. NCBI_GenBank
Match: EWM24909.1 (hypothetical protein Naga_100092g1 [Nannochloropsis gaditana]) HSP 1 Score: 139.0 bits (349), Expect = 7.800e-30 Identity = 63/78 (80.77%), Postives = 73/78 (93.59%), Query Frame = 0 Query: 1 MTTTRLVRPPRLLGFGGRPYNFFERDALPQNLSSVLKGKFAAVLMVEGALIFGDDQGHITFTDADLRLSLQHRILSPP 79 M++++LVRPPRLLGFGGRPYNFF+RD+LP+NLSSVLKG A+ L+VEGALIF DDQGHITFTDADL +SLQHRILSPP Sbjct: 1 MSSSKLVRPPRLLGFGGRPYNFFDRDSLPRNLSSVLKGNLASALLVEGALIFADDQGHITFTDADLHVSLQHRILSPP 78 The following BLAST results are available for this feature:
BLAST of NO11G02510 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 2
Relationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO11G02510 ID=NO11G02510|Name=NO11G02510|organism=Nannochloropsis oceanica|type=gene|length=550bpback to top protein sequence of NO11G02510.1 >NO11G02510.1-protein ID=NO11G02510.1-protein|Name=NO11G02510.1|organism=Nannochloropsis oceanica|type=polypeptide|length=100bpback to top Synonyms
Publications
|