NO10G03530, NO10G03530 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
Homology
BLAST of NO10G03530 vs. NCBI_GenBank
Match: EWM25323.1 (hypothetical protein Naga_100281g10 [Nannochloropsis gaditana]) HSP 1 Score: 83.2 bits (204), Expect = 9.000e-13 Identity = 39/79 (49.37%), Postives = 56/79 (70.89%), Query Frame = 0 Query: 91 ANLAGLRVCSPVDGPDLERMVAGSSTCGVILLTKGSMVPYFTENTMVVSTRKIIVGHPIDLPQIRTVGKLERVFDVVSG 170 ANLAGL+VC P +G +L+ M S+C VI+L KGS Y +T++V++RKI++GHPIDLPQI ++ R+F+V G Sbjct: 153 ANLAGLQVCYPQNGEELKGMTESGSSCSVIILKKGSSDKYTLPSTVIVTSRKIVLGHPIDLPQIHPDKEVYRLFEVKPG 231
BLAST of NO10G03530 vs. NCBI_GenBank
Match: XP_005854415.1 (hypothetical protein NGA_0231400, partial [Nannochloropsis gaditana CCMP526] >EKU21941.1 hypothetical protein NGA_0231400, partial [Nannochloropsis gaditana CCMP526]) HSP 1 Score: 82.8 bits (203), Expect = 1.200e-12 Identity = 39/79 (49.37%), Postives = 55/79 (69.62%), Query Frame = 0 Query: 91 ANLAGLRVCSPVDGPDLERMVAGSSTCGVILLTKGSMVPYFTENTMVVSTRKIIVGHPIDLPQIRTVGKLERVFDVVSG 170 ANLAGL+VC P +G +L+ M S+C VI+L KGS Y +T++V++RKI++GHPIDLPQI + R+F+V G Sbjct: 153 ANLAGLQVCYPQNGEELKGMTESGSSCSVIILKKGSSDKYTLPSTVIVTSRKIVLGHPIDLPQIHPDNGVYRLFEVKPG 231
BLAST of NO10G03530 vs. NCBI_GenBank
Match: XP_005853421.1 (hypothetical protein NGA_0438900, partial [Nannochloropsis gaditana CCMP526] >EKU22940.1 hypothetical protein NGA_0438900, partial [Nannochloropsis gaditana CCMP526]) HSP 1 Score: 80.9 bits (198), Expect = 4.500e-12 Identity = 38/80 (47.50%), Postives = 55/80 (68.75%), Query Frame = 0 Query: 91 ANLAGLRVCSPVDGPDLERMVAGSSTCGVILLTKGSMVPYFTENTMVVSTRKIIVGHPIDLPQIRTVGKLERVFDVVSGA 171 A+LAGL+VC P GP+L+ MV S+C V++L KGS Y +T++V++ II+GHPID PQI + R+FDV +G+ Sbjct: 155 ASLAGLQVCYPETGPELKAMVESGSSCSVVILKKGSSYIYLLPSTVMVTSSVIILGHPIDPPQIHPEKGVYRLFDVAAGS 234
BLAST of NO10G03530 vs. NCBI_GenBank
Match: EWM25326.1 (hypothetical protein Naga_100880g2, partial [Nannochloropsis gaditana]) HSP 1 Score: 80.9 bits (198), Expect = 4.500e-12 Identity = 38/80 (47.50%), Postives = 55/80 (68.75%), Query Frame = 0 Query: 91 ANLAGLRVCSPVDGPDLERMVAGSSTCGVILLTKGSMVPYFTENTMVVSTRKIIVGHPIDLPQIRTVGKLERVFDVVSGA 171 A+LAGL+VC P GP+L+ MV S+C V++L KGS Y +T++V++ II+GHPID PQI + R+FDV +G+ Sbjct: 155 ASLAGLQVCYPETGPELKAMVESGSSCSVVILKKGSSYIYLLPSTVMVTSSVIILGHPIDPPQIHPEKGVYRLFDVAAGS 234 The following BLAST results are available for this feature:
BLAST of NO10G03530 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 4
Relationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO10G03530 ID=NO10G03530|Name=NO10G03530|organism=Nannochloropsis oceanica|type=gene|length=952bpback to top protein sequence of NO10G03530.1 >NO10G03530.1-protein ID=NO10G03530.1-protein|Name=NO10G03530.1|organism=Nannochloropsis oceanica|type=polypeptide|length=177bpback to top Synonyms
Publications
|