NO08G01840, NO08G01840 (gene) Nannochloropsis oceanica

Overview
NameNO08G01840
Unique NameNO08G01840
Typegene
OrganismNannochloropsis oceanica (N. oceanica IMET1)
Sequence length2367
Alignment locationchr8:564150..566516 -

Link to JBrowse

Properties
Property NameValue
DescriptionAureochrome1-like protein
Mutants
Expression

Hover the mouse over a column in the graph to view expression values.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

back to top
Alignments
The following features are aligned
Aligned FeatureFeature TypeAlignment Location
chr8genomechr8:564150..566516 -
Analyses
This gene is derived from or has results from the following analyses
Analysis NameDate Performed
PXD0160542021-01-14
PXD0166992021-01-08
GSE1499042020-10-10
NoIMET1_WT_HS2020-09-29
PXD0100302020-03-16
GSE1396152020-03-11
PRJNA2413822020-03-11
BLASTP analysis of N. oceanica IMET1 genes2019-07-11
InterPro analysis for N. oceanica IMET1 genes2019-07-11
GO annotation for IMET1v2 genes2019-07-10
PXD0087212019-04-30
PRJNA1821802019-04-25
Gene prediction for N. oceanica IMET12017-10-24
Annotated Terms
The following terms have been associated with this gene:
Vocabulary: Molecular Function
TermDefinition
GO:0000155phosphorelay sensor kinase activity
GO:0003700DNA-binding transcription factor activity
GO:0003700DNA-binding transcription factor activity
Vocabulary: Biological Process
TermDefinition
GO:0000160phosphorelay signal transduction system
GO:0006355regulation of transcription, DNA-templated
GO:0009058biosynthetic process
GO:0006139nucleobase-containing compound metabolic process
Vocabulary: INTERPRO
TermDefinition
IPR035965PAS-like_dom_sf
IPR000700PAS-assoc_C
IPR000014PAS
IPR001610PAC
IPR004827bZIP
Homology
BLAST of NO08G01840 vs. NCBI_GenBank
Match: XP_005854445.1 (hypothetical protein NGA_0015702 [Nannochloropsis gaditana CCMP526] >EKU21911.1 hypothetical protein NGA_0015702 [Nannochloropsis gaditana CCMP526] >EWM26768.1 aureochrome1-like protein [Nannochloropsis gaditana])

HSP 1 Score: 384.8 bits (987), Expect = 3.800e-103
Identity = 190/214 (88.79%), Postives = 203/214 (94.86%), Query Frame = 0
Query:  246 NREHAKRSRVRKKFLLESLQKSVNALQEENDKLRGAIRTHLKDGAHDLLKSCEVEPEDSLLTSDPASATKILDDPDYTLVKALQTAQQNFVITDPTLPDNPIVYASGGFLNLTGYQMDQILGRNCRFLQGPDTDPSAVDKIRRAIEDGTDGSVCLLNYRADGTTFWNQFFIAALRGADGNVVNFVGVQCRVSEEYALEVLKKEMESTTSTGAPS 460
            NREHAKRSRVRKKFLLESLQKSVNALQEENDKLRGAIR+HLK+GA DLLK+CEVE ++S+L SDP SATKILDDPDYTLVKALQTAQQNFVITDPTLPDNPIVYASGGFL+LTGYQMDQILGRNCRFLQGPDTDP+AVDKIRRAIEDGTDGSVCLLNYRADG+TFWNQFFIAALRGADGN+VN+VGVQC+VSEEYA EVLKKE  S+T   A S
Sbjct:   13 NREHAKRSRVRKKFLLESLQKSVNALQEENDKLRGAIRSHLKEGADDLLKTCEVEVDESILASDPCSATKILDDPDYTLVKALQTAQQNFVITDPTLPDNPIVYASGGFLSLTGYQMDQILGRNCRFLQGPDTDPAAVDKIRRAIEDGTDGSVCLLNYRADGSTFWNQFFIAALRGADGNIVNYVGVQCKVSEEYASEVLKKEATSSTVAEASS 226          
BLAST of NO08G01840 vs. NCBI_GenBank
Match: AML76369.1 (putative LOV domain-containing protein [Ishige okamurae])

HSP 1 Score: 296.2 bits (757), Expect = 1.800e-76
Identity = 145/215 (67.44%), Postives = 176/215 (81.86%), Query Frame = 0
Query:  246 NREHAKRSRVRKKFLLESLQKSVNALQEENDKLRGAIRTHLKDGAHDLLKSCEVEPEDSLLTSDPASATKILDDPDYTLVKALQTAQQNFVITDPTLPDNPIVYASGGFLNLTGYQMDQILGRNCRFLQGPDTDPSAVDKIRRAIEDGTDGSVCLLNYRADGTTFWNQFFIAALRGADGNVVNFVGVQCRVSEEYALEVLKKEMESTTSTGAPST 461
            NREHAKRSRVRKKFLL+SLQ+SV+ALQ END L+G+I   L D   +L+  C  E  + L+T++P  ATKILDDPDY+LVKALQTAQQNFVITD +LPDNPIV+AS GFL LTGY+++++LGRNCRFLQGP TDP AVDKIR+AIED +D SVCLLNYRADGTTFWNQFF+A+LR  DGN VN+VGVQC+V ++YA  ++  E     ST AP++
Sbjct:  352 NREHAKRSRVRKKFLLDSLQRSVDALQVENDSLKGSIVESLGDRGRELVAKCVPEEAEGLITANPKQATKILDDPDYSLVKALQTAQQNFVITDASLPDNPIVFASSGFLELTGYKLNEVLGRNCRFLQGPATDPKAVDKIRKAIEDKSDTSVCLLNYRADGTTFWNQFFVASLRDGDGNTVNYVGVQCKVGDDYA-RIVVGEQNRQLSTPAPAS 565          
BLAST of NO08G01840 vs. NCBI_GenBank
Match: AML77072.1 (putative LOV domain-containing protein [Sargassum integerrimum])

HSP 1 Score: 293.9 bits (751), Expect = 8.800e-76
Identity = 147/204 (72.06%), Postives = 169/204 (82.84%), Query Frame = 0
Query:  246 NREHAKRSRVRKKFLLESLQKSVNALQEENDKLRGAIRTHL-KDGAHDLLKSCEVEPEDSLLTSDPASATKILDDPDYTLVKALQTAQQNFVITDPTLPDNPIVYASGGFLNLTGYQMDQILGRNCRFLQGPDTDPSAVDKIRRAIEDGTDGSVCLLNYRADGTTFWNQFFIAALRGADGNVVNFVGVQCRVSEEYALEVLKKE 449
            NREHAKRSRVRKKFLLESLQKSV ALQEEN+KLRGAIR +L  + A +LL   E     SL++S P  ATK+LDDPDY+LVKALQTAQQNFVITDPTLPDNPIV+AS GFL LTGY +DQ+LGRNCRFLQGPDTDP AV+KIR+AIE G D SVCL NYR DG  FWNQFFIAALR ++G V+N+VGVQC+V +++   V K+E
Sbjct:   13 NREHAKRSRVRKKFLLESLQKSVTALQEENEKLRGAIRANLGPEEAKELLTQTET---SSLISSSPGEATKVLDDPDYSLVKALQTAQQNFVITDPTLPDNPIVFASQGFLELTGYTLDQVLGRNCRFLQGPDTDPKAVEKIRKAIEKGMDTSVCLRNYRVDGAMFWNQFFIAALRDSEGTVINYVGVQCKVDDDFVRAVQKRE 213          
BLAST of NO08G01840 vs. NCBI_GenBank
Match: AML79519.1 (putative LOV domain-containing protein [Sargassum thunbergii])

HSP 1 Score: 293.9 bits (751), Expect = 8.800e-76
Identity = 147/203 (72.41%), Postives = 168/203 (82.76%), Query Frame = 0
Query:  246 NREHAKRSRVRKKFLLESLQKSVNALQEENDKLRGAIRTHL-KDGAHDLLKSCEVEPEDSLLTSDPASATKILDDPDYTLVKALQTAQQNFVITDPTLPDNPIVYASGGFLNLTGYQMDQILGRNCRFLQGPDTDPSAVDKIRRAIEDGTDGSVCLLNYRADGTTFWNQFFIAALRGADGNVVNFVGVQCRVSEEYALEVLKK 448
            NREHAKRSRVRKKFLLESLQKSV ALQEEN+KLRGAIR +L  + A +LL   E     SL++S P  ATK+LDDPDY+LVKALQTAQQNFVITDPTLPDNPIV+AS GFL LTGY +DQ+LGRNCRFLQGPDTDP AV+KIR+AIE G D SVCL NYR DG  FWNQFFIAALR ++G V+N+VGVQC+V E++   V K+
Sbjct:   13 NREHAKRSRVRKKFLLESLQKSVTALQEENEKLRGAIRANLGPEEAKELLTQTET---SSLISSSPGEATKVLDDPDYSLVKALQTAQQNFVITDPTLPDNPIVFASQGFLELTGYTLDQVLGRNCRFLQGPDTDPKAVEKIRKAIEKGMDASVCLRNYRVDGAMFWNQFFIAALRDSEGTVINYVGVQCKVDEDFVRAVQKR 212          
BLAST of NO08G01840 vs. NCBI_GenBank
Match: AML77774.1 (putative LOV domain-containing protein [Dictyopteris undulata])

HSP 1 Score: 293.5 bits (750), Expect = 1.200e-75
Identity = 147/204 (72.06%), Postives = 170/204 (83.33%), Query Frame = 0
Query:  246 NREHAKRSRVRKKFLLESLQKSVNALQEENDKLRGAIRTHLK-DGAHDLLKSCEVEPEDSLLTSDPASATKILDDPDYTLVKALQTAQQNFVITDPTLPDNPIVYASGGFLNLTGYQMDQILGRNCRFLQGPDTDPSAVDKIRRAIEDGTDGSVCLLNYRADGTTFWNQFFIAALRGADGNVVNFVGVQCRVSEEYALEVLKKE 449
            NREHAKRSRVRKKFLLESLQKSV ALQEEN+KLRGAIR++L  + A +LL+  E     +L+ S+P  ATK+LDDPDY+LVKALQTAQQNFVITDPTLPDNPIV+AS GFL LTGY +DQ+LGRNCRFLQGPDTDP AV+KIR+AIE G D SVCL NYR DG  FWNQFFIAALR ++G V+N+VGVQC+V E++     KKE
Sbjct:   68 NREHAKRSRVRKKFLLESLQKSVTALQEENEKLRGAIRSNLSAEEAKELLEQTET---SNLIASNPGDATKVLDDPDYSLVKALQTAQQNFVITDPTLPDNPIVFASQGFLELTGYTLDQVLGRNCRFLQGPDTDPKAVEKIRKAIEKGMDTSVCLRNYRVDGVMFWNQFFIAALRDSEGAVINYVGVQCKVDEDFVRASQKKE 268          
BLAST of NO08G01840 vs. NCBI_GenBank
Match: AML77281.1 (putative LOV domain-containing protein [Sargassum vachellianum])

HSP 1 Score: 293.1 bits (749), Expect = 1.500e-75
Identity = 147/203 (72.41%), Postives = 168/203 (82.76%), Query Frame = 0
Query:  246 NREHAKRSRVRKKFLLESLQKSVNALQEENDKLRGAIRTHL-KDGAHDLLKSCEVEPEDSLLTSDPASATKILDDPDYTLVKALQTAQQNFVITDPTLPDNPIVYASGGFLNLTGYQMDQILGRNCRFLQGPDTDPSAVDKIRRAIEDGTDGSVCLLNYRADGTTFWNQFFIAALRGADGNVVNFVGVQCRVSEEYALEVLKK 448
            NREHAKRSRVRKKFLLESLQKSV ALQEEN+KLRGAIR +L  + A +LL   E     SL++S P  ATK+LDDPDY+LVKALQTAQQNFVITDPTLPDNPIV+AS GFL LTGY +DQ+LGRNCRFLQGPDTDP AV+KIR+AIE G D SVCL NYR DG  FWNQFFIAALR ++G V+N+VGVQC+V E++   V K+
Sbjct:   38 NREHAKRSRVRKKFLLESLQKSVTALQEENEKLRGAIRANLGPEEAKELLTQTET---SSLISSSPGEATKVLDDPDYSLVKALQTAQQNFVITDPTLPDNPIVFASQGFLELTGYTLDQVLGRNCRFLQGPDTDPKAVEKIRKAIEKGMDTSVCLRNYRVDGAMFWNQFFIAALRDSEGTVINYVGVQCKVDEDFVRAVQKR 237          
BLAST of NO08G01840 vs. NCBI_GenBank
Match: AML77738.1 (putative LOV domain-containing protein [Sargassum fusiforme])

HSP 1 Score: 293.1 bits (749), Expect = 1.500e-75
Identity = 147/203 (72.41%), Postives = 168/203 (82.76%), Query Frame = 0
Query:  246 NREHAKRSRVRKKFLLESLQKSVNALQEENDKLRGAIRTHL-KDGAHDLLKSCEVEPEDSLLTSDPASATKILDDPDYTLVKALQTAQQNFVITDPTLPDNPIVYASGGFLNLTGYQMDQILGRNCRFLQGPDTDPSAVDKIRRAIEDGTDGSVCLLNYRADGTTFWNQFFIAALRGADGNVVNFVGVQCRVSEEYALEVLKK 448
            NREHAKRSRVRKKFLLESLQKSV ALQEEN+KLRGAIR +L  + A +LL   E     SL++S P  ATK+LDDPDY+LVKALQTAQQNFVITDPTLPDNPIV+AS GFL LTGY +DQ+LGRNCRFLQGPDTDP AV+KIR+AIE G D SVCL NYR DG  FWNQFFIAALR ++G V+N+VGVQC+V E++   V K+
Sbjct:   13 NREHAKRSRVRKKFLLESLQKSVTALQEENEKLRGAIRANLGPEEAKELLTQTET---SSLISSSPGEATKVLDDPDYSLVKALQTAQQNFVITDPTLPDNPIVFASQGFLELTGYTLDQVLGRNCRFLQGPDTDPKAVEKIRKAIEKGMDTSVCLRNYRVDGAMFWNQFFIAALRDSEGTVINYVGVQCKVDEDFVRAVQKR 212          
BLAST of NO08G01840 vs. NCBI_GenBank
Match: CBN77970.1 (aureochrome 3 [Ectocarpus siliculosus])

HSP 1 Score: 292.7 bits (748), Expect = 2.000e-75
Identity = 147/206 (71.36%), Postives = 171/206 (83.01%), Query Frame = 0
Query:  246 NREHAKRSRVRKKFLLESLQKSVNALQEENDKLRGAIRTHL-KDGAHDLLKSCEVEPEDSLLTSDPASATKILDDPDYTLVKALQTAQQNFVITDPTLPDNPIVYASGGFLNLTGYQMDQILGRNCRFLQGPDTDPSAVDKIRRAIEDGTDGSVCLLNYRADGTTFWNQFFIAALRGADGNVVNFVGVQCRVSEEYALEVLKKEME 451
            NREHAKRSRVRKKFLLESLQKSV +LQEEN+KLRGAIR++L  + A +LL   E E   +L++S P  ATK+LDDPDY+LVKALQTAQQNFVITDPTLPDNPIV+AS GFL LTGY +DQ+LGRNCRFLQGPDTDP AV+KIR+AIE G D SVCL NYR DG  FWNQFFIAALR ++G V+N+VGVQC+V E++   V + E E
Sbjct:   48 NREHAKRSRVRKKFLLESLQKSVTSLQEENEKLRGAIRSNLGPEEAKELL--AETETPTTLISSRPGDATKVLDDPDYSLVKALQTAQQNFVITDPTLPDNPIVFASQGFLELTGYTLDQVLGRNCRFLQGPDTDPKAVEKIRKAIEKGMDTSVCLRNYRVDGAMFWNQFFIAALRDSEGTVINYVGVQCKVDEDFVRAVQRTEGE 251          
BLAST of NO08G01840 vs. NCBI_GenBank
Match: AML79083.1 (putative LOV domain-containing protein [Sargassum hemiphyllum])

HSP 1 Score: 292.0 bits (746), Expect = 3.400e-75
Identity = 146/203 (71.92%), Postives = 168/203 (82.76%), Query Frame = 0
Query:  246 NREHAKRSRVRKKFLLESLQKSVNALQEENDKLRGAIRTHL-KDGAHDLLKSCEVEPEDSLLTSDPASATKILDDPDYTLVKALQTAQQNFVITDPTLPDNPIVYASGGFLNLTGYQMDQILGRNCRFLQGPDTDPSAVDKIRRAIEDGTDGSVCLLNYRADGTTFWNQFFIAALRGADGNVVNFVGVQCRVSEEYALEVLKK 448
            NREHAKRSRVRKKFLLESLQKSV ALQEEN+KLRGAIR++L  + A +LL   E     SL++S P  ATK+LDDPDY+LVKALQTAQQNFVITDPTLPDNPIV+AS GFL LTGY +DQ+LGRNCRFLQGPDTDP AV+KIR+AIE G D SVCL NYR DG  FWNQFFIAALR ++G V+N+VGVQC+V E++     K+
Sbjct:  219 NREHAKRSRVRKKFLLESLQKSVTALQEENEKLRGAIRSNLGPEEAKELLTQTET---SSLISSSPGEATKVLDDPDYSLVKALQTAQQNFVITDPTLPDNPIVFASQGFLELTGYTLDQVLGRNCRFLQGPDTDPKAVEKIRKAIEKGMDTSVCLRNYRVDGAMFWNQFFIAALRDSEGTVINYVGVQCKVDEDFVRAAQKR 418          
BLAST of NO08G01840 vs. NCBI_GenBank
Match: AML78526.1 (putative LOV domain-containing protein [Sargassum horneri])

HSP 1 Score: 291.2 bits (744), Expect = 5.700e-75
Identity = 146/203 (71.92%), Postives = 167/203 (82.27%), Query Frame = 0
Query:  246 NREHAKRSRVRKKFLLESLQKSVNALQEENDKLRGAIRTHL-KDGAHDLLKSCEVEPEDSLLTSDPASATKILDDPDYTLVKALQTAQQNFVITDPTLPDNPIVYASGGFLNLTGYQMDQILGRNCRFLQGPDTDPSAVDKIRRAIEDGTDGSVCLLNYRADGTTFWNQFFIAALRGADGNVVNFVGVQCRVSEEYALEVLKK 448
            NREHAKRSRVRKKFLLESLQKSV ALQEEN+KLRGAIR +L  + A +LL   E     SL++S P  ATK+LDDPDY+LVKALQTAQQNFVITDPTLPDNPIV+AS GFL LTGY +DQ+LGRNCRFLQGPDTDP AV+KIR+AIE G D SVCL NYR DG  FWNQFFIAALR ++G V+N+VGVQC+V E++     K+
Sbjct:   13 NREHAKRSRVRKKFLLESLQKSVTALQEENEKLRGAIRANLGPEEAKELLTQTET---SSLISSSPGEATKVLDDPDYSLVKALQTAQQNFVITDPTLPDNPIVFASQGFLELTGYTLDQVLGRNCRFLQGPDTDPKAVEKIRKAIEKGMDASVCLRNYRVDGAMFWNQFFIAALRDSEGIVINYVGVQCKVDEDFVRAAQKR 212          
The following BLAST results are available for this feature:
BLAST of NO08G01840 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes)
Total hits: 20
Match NameE-valueIdentityDescription
XP_005854445.13.800e-10388.79hypothetical protein NGA_0015702 [Nannochloropsis ... [more]
AML76369.11.800e-7667.44putative LOV domain-containing protein [Ishige oka... [more]
AML77072.18.800e-7672.06putative LOV domain-containing protein [Sargassum ... [more]
AML79519.18.800e-7672.41putative LOV domain-containing protein [Sargassum ... [more]
AML77774.11.200e-7572.06putative LOV domain-containing protein [Dictyopter... [more]
AML77281.11.500e-7572.41putative LOV domain-containing protein [Sargassum ... [more]
AML77738.11.500e-7572.41putative LOV domain-containing protein [Sargassum ... [more]
CBN77970.12.000e-7571.36aureochrome 3 [Ectocarpus siliculosus][more]
AML79083.13.400e-7571.92putative LOV domain-containing protein [Sargassum ... [more]
AML78526.15.700e-7571.92putative LOV domain-containing protein [Sargassum ... [more]

Pages

back to top
Relationships

This gene is member of the following syntenic_region feature(s):

Feature NameUnique NameSpeciesType
nonsL109nonsL109Nannochloropsis oceanica (N. oceanica IMET1)syntenic_region
nonsL106nonsL106Nannochloropsis oceanica (N. oceanica IMET1)syntenic_region
ncniR083ncniR083Nannochloropsis oceanica (N. oceanica IMET1)syntenic_region
ngnoR141ngnoR141Nannochloropsis oceanica (N. oceanica IMET1)syntenic_region
ngnoR139ngnoR139Nannochloropsis oceanica (N. oceanica IMET1)syntenic_region


This gene is orthologous to the following gene feature(s):

Feature NameUnique NameSpeciesType
NSK008866NSK008866Nannochloropsis salina (N. salina CCMP1776)gene


The following polypeptide feature(s) derives from this gene:

Feature NameUnique NameSpeciesType
NO08G01840.1NO08G01840.1-proteinNannochloropsis oceanica (N. oceanica IMET1)polypeptide


The following gene feature(s) are orthologous to this gene:

Feature NameUnique NameSpeciesType
jgi.p|Nanoce1779_2|582424gene_3513Nannochloropsis oceanica (N. oceanica CCMP1779)gene
AUR3gene3884Nannochloropsis gaditana (N. gaditana B-31)gene


The following mRNA feature(s) are a part of this gene:

Feature NameUnique NameSpeciesType
NO08G01840.1NO08G01840.1Nannochloropsis oceanica (N. oceanica IMET1)mRNA


Sequences
The following sequences are available for this feature:

gene sequence

>NO08G01840 ID=NO08G01840|Name=NO08G01840|organism=Nannochloropsis oceanica|type=gene|length=2367bp
AACCTCACACACCCTCCATTTTCTCTGGAGTACATGAAGCCAGAGTGCAA
CAACCGTCCTCCACTGCGATATTTTTGGCACCTCACTCAATCCTTGTGAC
CATCTCTCCAATCTTCCTTAGTTGTTGTTATTATAAGAGTAGGATGGCGC
TTCTGAGGGCAGGCGCGATCGTGTGGTGAAGCTGTCGCGCTTGATATGGG
AAGATCCTGCGCTTCACATGCCGACTTGCTTCTTTGATGATTGGGAGTCT
TGCATTTAATGTCGCCCTCCTTCGGTCCCACCCTGCGTGCATCACGCTGG
CACATTTAAGCATGATGCGGACAATTACCTGCGGTCGCGACACGGGCCTG
GTTTGTGGCATTCGGTCTTTCGCCTGGAACAGAATTTCGCCTCATGGCCG
GTAGCTTTCATCGAGCATCTATCATCCATGGCTCCTTCGGTTGTGTTATA
GGACATTTTTGGTCTCTATACTTTTACTATCAGTGAAATATACGCTATTT
CATTACTTCCGAAGCCCGGGAATTTCCGGCTGGCCAATCTTAAGACCTGT
CGACGCTCCATAGTCCCGAGCATGACAGGGTCTACGCCACTGCCGCTACT
TGCTGTTGGTCGCCTTAGCATCCTCATCCCAGCATTTCTAACCCTTTCTC
CTCTTTCTCCCCGCGCTTCATAATGCACAGCATAACATACGTACTGGCGG
GCACATAAGCCCTTGATCTCGGGGCATTTTATCGCGCTCTCCTTTCCTCA
ACCCCCGCTGTCCCAAGCCACTGGCGATTAACCACGGTCTCAGTTGCCTA
CCCGCCGATGGAAGGGCTAGGACAGCCGGGAGATGCCGGGGGGGGAAGTG
GCAGCAGTACTGGTGGAGGTGCATCAGCAGGAGCCAGCGCCAGCTTCCCC
CCTCCTCCAGTCTTTGGCTTCTCCAGGGACGACTCGATTAATCTGGAGGA
CATCTTCGTAGATTGGTTCAACGAAGATAATCTCAACGGCCCGCCTTCTT
CCTATCAAAGTAGTAGCCAGGATTCTGCTGCTCCTGCTATCCTTCCGCAA
GAGGCTTATGTCCCCGCCCTCACCACCGCTCAGAAGCTCCAGCAGTTGCA
ACAGCTTCAACAGCAGCAACGACTGGAGCAGCAGCAGCTTCTGGCGTCGC
ACCAGGCGTCAGAGCAGCAGCAGCAGCAGCAGCAGCAGCAGTTCCAGCAG
TCAGGAATTGGGAAGGCAGGGAGAACGTCGCCATTGACGATGATGATGCC
TACGGGAGGAGATAAAAGCAAGGCTGCTGGTGCTGCTACTGTTGGTGGTG
GGAGGGCCACGGTGGTGAACAATGGAGGAGGAATGGGAGGGGTTGAGGAC
GAGGAAGGGGAGGAGGACGACTTTGAGGATGACTATGAGGACGATGATGG
GGGGACTAGCACAGGGAGTGGAGGGGGAGGAGGAGGGCGACGCAAGAAGC
GGCAAAGGGGCGCGGGAGGGGGGGGAAGTATGGGTGGAGGGAGTTCGGGG
AGGAGGATGACTGAGGAGCAGAAAGTGGAAAGGCGGGAGAGGAATCGGGA
GCATGCCAAACGGTCCCGTGTGAGGAAGAAGTTCTTGTTGGAGTCATTGC
AGAAGAGCGTGAATGCCTTGCAGGAGGAGAACGACAAGCTGCGGGGGGCC
ATTCGCACGCATCTCAAGGACGGGGCACACGATTTACTCAAGTCGTGTGA
GGTGGAGCCGGAGGACTCTTTGTTGACCTCAGATCCTGCATCGGCGACCA
AGATTTTGGATGATCCAGATTACACCCTTGTGAAGGCCCTACAGACCGCC
CAGCAGAACTTCGTGATCACCGACCCGACGCTGCCTGACAATCgtaagtt
ggctgaaagggagtttggctgtgtgggttccgtgactgcttatatacgtg
taccacaagaatagatcaagataaccaccactttttgctccacttatcgc
ccccccctctccccctcttctctctctcactctctcctgtttttgcacac
agCCATTGTCTACGCCTCTGGCGGCTTTTTAAATCTCACCGGCTACCAAA
TGGATCAAATCCTCGGCCGCAACTGTCGCTTCCTCCAAGGGCCTGACACG
GACCCTTCCGCCGTGGACAAGATCCGAAGAGCCATCGAAGATGGGACAGA
CGGGAGCGTGTGTCTGTTGAATTACCGCGCGGACGGCACGACTTTTTGGA
ACCAGTTTTTCATCGCGGCCCTGCGTGGGGCGGATGGGAACGTTGTCAAC
TTTGTTGGTGTACAATGCCGTGTGAGCGAGGAGTACGCGCTGGAGGTGCT
GAAAAAGGAGATGGAGAGCACGACCTCGACGGGGGCGCCGTCGACGGGGA
TGCATTTGAAGGGATAG
back to top

protein sequence of NO08G01840.1

>NO08G01840.1-protein ID=NO08G01840.1-protein|Name=NO08G01840.1|organism=Nannochloropsis oceanica|type=polypeptide|length=467bp
MEGLGQPGDAGGGSGSSTGGGASAGASASFPPPPVFGFSRDDSINLEDIF
VDWFNEDNLNGPPSSYQSSSQDSAAPAILPQEAYVPALTTAQKLQQLQQL
QQQQRLEQQQLLASHQASEQQQQQQQQQFQQSGIGKAGRTSPLTMMMPTG
GDKSKAAGAATVGGGRATVVNNGGGMGGVEDEEGEEDDFEDDYEDDDGGT
STGSGGGGGGRRKKRQRGAGGGGSMGGGSSGRRMTEEQKVERRERNREHA
KRSRVRKKFLLESLQKSVNALQEENDKLRGAIRTHLKDGAHDLLKSCEVE
PEDSLLTSDPASATKILDDPDYTLVKALQTAQQNFVITDPTLPDNPIVYA
SGGFLNLTGYQMDQILGRNCRFLQGPDTDPSAVDKIRRAIEDGTDGSVCL
LNYRADGTTFWNQFFIAALRGADGNVVNFVGVQCRVSEEYALEVLKKEME
STTSTGAPSTGMHLKG*
back to top
Synonyms
Publications