NO22G00440, NO22G00440 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
Homology
BLAST of NO22G00440 vs. NCBI_GenBank
Match: EWM21386.1 (hypothetical protein Naga_100215g11 [Nannochloropsis gaditana]) HSP 1 Score: 118.2 bits (295), Expect = 2.700e-23 Identity = 63/95 (66.32%), Postives = 74/95 (77.89%), Query Frame = 0 Query: 1 MTELLGMNTEALGHLFGTLMGFAETATGVLAMLTGRPSALLMSQERGEGEEG-TEEEVALREKQARTIKVVRWVLGLVVSYIMWRVARKVGRWVK 95 MTELLGMNTEALG+LFGTLMGFAETA VL LT RP+ LL + G+EG TEEE A+R KQ + ++VVRW +GL +SY+ WRV RKVGRWVK Sbjct: 281 MTELLGMNTEALGYLFGTLMGFAETAGNVLGQLTARPARLLEA-----GQEGVTEEEAAVRAKQEKIVRVVRWAVGLALSYLAWRVLRKVGRWVK 370 The following BLAST results are available for this feature:
BLAST of NO22G00440 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 1
Relationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO22G00440 ID=NO22G00440|Name=NO22G00440|organism=Nannochloropsis oceanica|type=gene|length=570bpback to top protein sequence of NO22G00440.1 >NO22G00440.1-protein ID=NO22G00440.1-protein|Name=NO22G00440.1|organism=Nannochloropsis oceanica|type=polypeptide|length=190bpback to top Synonyms
Publications
|