NO22G00160.1, NO22G00160.1 (mRNA) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
No biomaterial libraries express this feature.
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Annotated Terms
Homology
BLAST of NO22G00160.1 vs.
Match: EWM27381.1 (hypothetical protein Naga_100438g3 [Nannochloropsis gaditana]) HSP 1 Score: 125.2 bits (313), Expect = 9.800e-26 Identity = 57/82 (69.51%), Postives = 63/82 (76.83%), Query Frame = 0 Query: 1 MKTSVVASVWDARPSFQLQYGDQRHLLGALLMRDEVREVQPGLFLGMGTYGYSAAKRHQDPLPFLLRGPLQPPKPKEVREGW 83 M T + SVWD RPSFQLQY + HLLG L MRDEVRE+QPGL+LGMGT+GYS AKR DPLPFLLRGP Q P P VRE + Sbjct: 158 MHTCITTSVWDGRPSFQLQYAGETHLLGRLRMRDEVREIQPGLYLGMGTFGYSEAKRRGDPLPFLLRGPYQAPVPGAVRESF 239 The following BLAST results are available for this feature:
BLAST of NO22G00160.1 vs.
Analysis Date: 2017-10-25 (Homology annotation for N. oceanica IMET1) Total hits: 1
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >NO22G00160.1 ID=NO22G00160.1|Name=NO22G00160.1|organism=Nannochloropsis oceanica|type=mRNA|length=403bpback to top protein sequence of NO22G00160.1 >NO22G00160.1-protein ID=NO22G00160.1-protein|Name=NO22G00160.1|organism=Nannochloropsis oceanica|type=polypeptide|length=84bpback to top mRNA from alignment at chr22:64971..65844+ Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>NO22G00160.1 ID=NO22G00160.1|Name=NO22G00160.1|organism=Nannochloropsis oceanica|type=mRNA|length=874bp|location=Sequence derived from alignment at chr22:64971..65844+ (Nannochloropsis oceanica)back to top Coding sequence (CDS) from alignment at chr22:64971..65844+ >NO22G00160.1 ID=NO22G00160.1|Name=NO22G00160.1|organism=Nannochloropsis oceanica|type=CDS|length=252bp|location=Sequence derived from alignment at chr22:64971..65844+ (Nannochloropsis oceanica)back to top Synonyms
Publications
|