NO30G00940.1, NO30G00940.1 (mRNA) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
No biomaterial libraries express this feature.
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Annotated Terms
Homology
BLAST of NO30G00940.1 vs.
Match: XP_003719350.1 (hypothetical protein MGG_01909 [Magnaporthe oryzae 70-15]; EHA46983.1 hypothetical protein MGG_01909 [Magnaporthe oryzae 70-15]; ELQ35505.1 hypothetical protein OOU_Y34scaffold00706g9 [Magnaporthe oryzae Y34]; ELQ69547.1 hypothetical protein OOW_P131scaffold00145g4 [Magnaporthe oryzae P131]) HSP 1 Score: 98.6 bits (244), Expect = 2.100e-17 Identity = 61/144 (42.36%), Postives = 84/144 (58.33%), Query Frame = 0 Query: 42 TPEFLEAAAVRDLILAQRDQAASQRKVQIVDVRGSDFSEGKLPGALNVASEGLKDMDRVDKLVEELMDKEMVIFHCGKSHQRGPQSAARFLSRLQ----------AATAAAVAAGKDVGPKVYVLKGGWEGWQKQYGEEEGMVE 176 T E + AA +RDL+LA++ A KV +VDVR D+ G + GALNV S+ L+ R+ L+ +L DK VIFHC S QRGP +A R++ AA ++A A + V KVYVL G+ GWQ+ YGE+E + E Sbjct: 6 TLERIPAAKLRDLLLAEK---ADDPKVAVVDVRDDDYIGGHIKGALNVPSQQLEA--RMPTLIRQLQDKPTVIFHCALSQQRGPGAALRYIRERDEALKKANDKDAAASSAPGASQPVEQKVYVLDRGFVGWQEVYGEDENLTE 144 The following BLAST results are available for this feature:
BLAST of NO30G00940.1 vs.
Analysis Date: 2017-10-25 (Homology annotation for N. oceanica IMET1) Total hits: 1
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >NO30G00940.1 ID=NO30G00940.1|Name=NO30G00940.1|organism=Nannochloropsis oceanica|type=mRNA|length=549bpback to top protein sequence of NO30G00940.1 >NO30G00940.1-protein ID=NO30G00940.1-protein|Name=NO30G00940.1|organism=Nannochloropsis oceanica|type=polypeptide|length=183bpback to top mRNA from alignment at chr30:352270..353701- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>NO30G00940.1 ID=NO30G00940.1|Name=NO30G00940.1|organism=Nannochloropsis oceanica|type=mRNA|length=1432bp|location=Sequence derived from alignment at chr30:352270..353701- (Nannochloropsis oceanica)back to top Coding sequence (CDS) from alignment at chr30:352270..353701- >NO30G00940.1 ID=NO30G00940.1|Name=NO30G00940.1|organism=Nannochloropsis oceanica|type=CDS|length=549bp|location=Sequence derived from alignment at chr30:352270..353701- (Nannochloropsis oceanica)back to top Synonyms
Publications
|