NO26G00020.1, NO26G00020.1 (mRNA) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
No biomaterial libraries express this feature.
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Annotated Terms
Homology
BLAST of NO26G00020.1 vs.
Match: EWM26025.1 (Winged helix-turn-helix transcription repressor [Nannochloropsis gaditana]) HSP 1 Score: 137.1 bits (344), Expect = 6.300e-29 Identity = 73/93 (78.49%), Postives = 82/93 (88.17%), Query Frame = 0 Query: 71 SNKHTSSSSSSGPTDAQISATILALTDKRGTTKTICPSEVPRLLCPSTWRAYMPRVRAVAIRLAKEGRIDITQKGQVVVVETEEDIQGPIRLR 164 S+ TSSSS+S PTD+QIS+TILALT +RG +TICPSEVPR+LCPS WRAYMPRVRAVAIRLAKEG IDITQ+GQVV VE E DI+GPIRLR Sbjct: 24 SSTVTSSSSASPPTDSQISSTILALTTRRGPCRTICPSEVPRVLCPSNWRAYMPRVRAVAIRLAKEGLIDITQRGQVVTVEKEGDIRGPIRLR 116 The following BLAST results are available for this feature:
BLAST of NO26G00020.1 vs.
Analysis Date: 2017-10-25 (Homology annotation for N. oceanica IMET1) Total hits: 1
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >NO26G00020.1 ID=NO26G00020.1|Name=NO26G00020.1|organism=Nannochloropsis oceanica|type=mRNA|length=884bpback to top protein sequence of NO26G00020.1 >NO26G00020.1-protein ID=NO26G00020.1-protein|Name=NO26G00020.1|organism=Nannochloropsis oceanica|type=polypeptide|length=212bpback to top mRNA from alignment at chr26:4497..5380+ Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>NO26G00020.1 ID=NO26G00020.1|Name=NO26G00020.1|organism=Nannochloropsis oceanica|type=mRNA|length=884bp|location=Sequence derived from alignment at chr26:4497..5380+ (Nannochloropsis oceanica)back to top Coding sequence (CDS) from alignment at chr26:4497..5380+ >NO26G00020.1 ID=NO26G00020.1|Name=NO26G00020.1|organism=Nannochloropsis oceanica|type=CDS|length=636bp|location=Sequence derived from alignment at chr26:4497..5380+ (Nannochloropsis oceanica)back to top Synonyms
Publications
|