NO24G02050.1, NO24G02050.1 (mRNA) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
No biomaterial libraries express this feature.
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Annotated Terms
Homology
BLAST of NO24G02050.1 vs.
Match: EWM24417.1 (hypothetical protein Naga_101269g1, partial [Nannochloropsis gaditana]) HSP 1 Score: 107.1 bits (266), Expect = 2.500e-20 Identity = 48/72 (66.67%), Postives = 60/72 (83.33%), Query Frame = 0 Query: 1 MLTTPFSWKEGFTPKERWLGGAAPEHLDSLSELKKEMEGMDYVLVREEEMPLVIRQHSRLYELIAAQATVWQ 73 MLTTPFSWKE FTPKE+WLGGAAP+ DS +ELK+ M G+ + L++E+EMPL+I QH+RL+ELI ATVWQ Sbjct: 54 MLTTPFSWKECFTPKEKWLGGAAPDGKDSHAELKRLMGGLGFKLLKEQEMPLIIHQHARLFELITPMATVWQ 125 The following BLAST results are available for this feature:
BLAST of NO24G02050.1 vs.
Analysis Date: 2017-10-25 (Homology annotation for N. oceanica IMET1) Total hits: 1
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >NO24G02050.1 ID=NO24G02050.1|Name=NO24G02050.1|organism=Nannochloropsis oceanica|type=mRNA|length=228bpback to top protein sequence of NO24G02050.1 >NO24G02050.1-protein ID=NO24G02050.1-protein|Name=NO24G02050.1|organism=Nannochloropsis oceanica|type=polypeptide|length=76bpback to top mRNA from alignment at chr24:542664..543106- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>NO24G02050.1 ID=NO24G02050.1|Name=NO24G02050.1|organism=Nannochloropsis oceanica|type=mRNA|length=443bp|location=Sequence derived from alignment at chr24:542664..543106- (Nannochloropsis oceanica)back to top Coding sequence (CDS) from alignment at chr24:542664..543106- >NO24G02050.1 ID=NO24G02050.1|Name=NO24G02050.1|organism=Nannochloropsis oceanica|type=CDS|length=228bp|location=Sequence derived from alignment at chr24:542664..543106- (Nannochloropsis oceanica)back to top Synonyms
Publications
|