NO03G01130.1, NO03G01130.1 (mRNA) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
No biomaterial libraries express this feature.
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Annotated Terms
Homology
BLAST of NO03G01130.1 vs.
Match: EWM29598.1 (hypothetical protein Naga_100006g45 [Nannochloropsis gaditana]) HSP 1 Score: 76.6 bits (187), Expect = 5.900e-11 Identity = 34/57 (59.65%), Postives = 45/57 (78.95%), Query Frame = 0 Query: 57 KYLQAYHHQTKAENPLYRTSQSVIGAHPPSVATVVTERYAIPQAFSSSVGNILFSDQ 114 KY +AY H+TK EN LYRTSQSVIGA PP++AT+VTE + PQ FS S+G++ + +Q Sbjct: 31 KYFRAYRHETKVENALYRTSQSVIGARPPTIATIVTETHKFPQPFSKSLGSLSYRNQ 87 The following BLAST results are available for this feature:
BLAST of NO03G01130.1 vs.
Analysis Date: 2017-10-25 (Homology annotation for N. oceanica IMET1) Total hits: 1
Relationships
This mRNA is a part of the following gene feature(s):
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
mRNA sequence >NO03G01130.1 ID=NO03G01130.1|Name=NO03G01130.1|organism=Nannochloropsis oceanica|type=mRNA|length=375bpback to top protein sequence of NO03G01130.1 >NO03G01130.1-protein ID=NO03G01130.1-protein|Name=NO03G01130.1|organism=Nannochloropsis oceanica|type=polypeptide|length=125bpback to top mRNA from alignment at chr3:351051..351425- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>NO03G01130.1 ID=NO03G01130.1|Name=NO03G01130.1|organism=Nannochloropsis oceanica|type=mRNA|length=375bp|location=Sequence derived from alignment at chr3:351051..351425- (Nannochloropsis oceanica)back to top Coding sequence (CDS) from alignment at chr3:351051..351425- >NO03G01130.1 ID=NO03G01130.1|Name=NO03G01130.1|organism=Nannochloropsis oceanica|type=CDS|length=375bp|location=Sequence derived from alignment at chr3:351051..351425- (Nannochloropsis oceanica)back to top Synonyms
Publications
|