NO30G00430, NO30G00430 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO30G00430 vs. NCBI_GenBank
Match: EWM20583.1 (Zinc finger, RING-type [Nannochloropsis gaditana]) HSP 1 Score: 116.3 bits (290), Expect = 1.500e-22 Identity = 48/63 (76.19%), Postives = 56/63 (88.89%), Query Frame = 0 Query: 130 LKTAHVDKHCSICLADYEEGDTLCVLPCRHSYHDDCLDHWITAHSKCPLCNYDLLLAGAATAA 193 LK A VD+HCSICL DYEEG+TLC+LPCRH+YHDDCL+ WI+AH+KCPLCNYDLLLA A A+ Sbjct: 124 LKRARVDRHCSICLGDYEEGETLCLLPCRHTYHDDCLNVWISAHAKCPLCNYDLLLAQATAAS 186
BLAST of NO30G00430 vs. NCBI_GenBank
Match: XP_002287178.1 (predicted protein [Thalassiosira pseudonana CCMP1335] >EED94621.1 predicted protein [Thalassiosira pseudonana CCMP1335]) HSP 1 Score: 83.2 bits (204), Expect = 1.400e-12 Identity = 41/90 (45.56%), Postives = 51/90 (56.67%), Query Frame = 0 Query: 129 LLKTAHVDKHCSICLADYEEGDTLCVLPCRHSYHDDCLDHWITAHSKCPLCNYDLLLAGAATAATLPPSFRGGQDQIMPMAPRHGRRVGG 219 LL + + CSICL +YE+GD + LPC H YH CLD W T H +CPLCNYDL+ PP+ + GQ Q PR+G V G Sbjct: 347 LLLSDDEEPSCSICLCEYEKGDAVTRLPCHHIYHKSCLDSWTTNHVRCPLCNYDLM------EGFDPPAIQAGQQQ-----PRNGASVVG 425
BLAST of NO30G00430 vs. NCBI_GenBank
Match: XP_004022041.1 (PREDICTED: E3 ubiquitin-protein ligase RLIM-like [Ovis aries]) HSP 1 Score: 75.9 bits (185), Expect = 2.200e-10 Identity = 25/43 (58.14%), Postives = 34/43 (79.07%), Query Frame = 0 Query: 137 KHCSICLADYEEGDTLCVLPCRHSYHDDCLDHWITAHSKCPLC 180 K CSIC+ +Y G+TLC+LPC H YHD C+DHW++ H+ CP+C Sbjct: 580 KVCSICITEYTTGNTLCILPCSHEYHDHCIDHWLSEHTTCPIC 622
BLAST of NO30G00430 vs. NCBI_GenBank
Match: XP_012028539.1 (PREDICTED: E3 ubiquitin-protein ligase RLIM-like [Ovis aries musimon]) HSP 1 Score: 75.9 bits (185), Expect = 2.200e-10 Identity = 25/43 (58.14%), Postives = 34/43 (79.07%), Query Frame = 0 Query: 137 KHCSICLADYEEGDTLCVLPCRHSYHDDCLDHWITAHSKCPLC 180 K CSIC+ +Y G+TLC+LPC H YHD C+DHW++ H+ CP+C Sbjct: 580 KVCSICITEYTTGNTLCILPCSHEYHDHCIDHWLSEHTTCPIC 622
BLAST of NO30G00430 vs. NCBI_GenBank
Match: XP_005701015.2 (PREDICTED: E3 ubiquitin-protein ligase RLIM-like [Capra hircus]) HSP 1 Score: 75.9 bits (185), Expect = 2.200e-10 Identity = 25/43 (58.14%), Postives = 33/43 (76.74%), Query Frame = 0 Query: 137 KHCSICLADYEEGDTLCVLPCRHSYHDDCLDHWITAHSKCPLC 180 K CSIC+ +Y G+TLC+LPC H YHD C+DHW+ H+ CP+C Sbjct: 579 KACSICITEYTAGNTLCILPCSHEYHDHCIDHWLAEHTTCPIC 621
BLAST of NO30G00430 vs. NCBI_GenBank
Match: GAX24728.1 (hypothetical protein FisN_4Hh286 [Fistulifera solaris]) HSP 1 Score: 74.7 bits (182), Expect = 4.900e-10 Identity = 27/48 (56.25%), Postives = 34/48 (70.83%), Query Frame = 0 Query: 136 DKHCSICLADYEEGDTLCVLPCRHSYHDDCLDHWITAHSKCPLCNYDL 184 + HCSICL +YE GD LPC H YH++C+ W T H+KCPLCN +L Sbjct: 257 EPHCSICLCEYEGGDACVKLPCHHIYHEECISSWTTNHTKCPLCNLEL 304
BLAST of NO30G00430 vs. NCBI_GenBank
Match: GAX24196.1 (hypothetical protein FisN_4Lh286 [Fistulifera solaris]) HSP 1 Score: 74.3 bits (181), Expect = 6.400e-10 Identity = 27/48 (56.25%), Postives = 33/48 (68.75%), Query Frame = 0 Query: 136 DKHCSICLADYEEGDTLCVLPCRHSYHDDCLDHWITAHSKCPLCNYDL 184 + HCSICL +YE GD LPC H YHD+C+ W H+KCPLCN +L Sbjct: 269 EPHCSICLCEYEGGDACVKLPCHHIYHDECISSWTVNHTKCPLCNLEL 316
BLAST of NO30G00430 vs. NCBI_GenBank
Match: XP_004356497.1 (zinc finger, C3HC4 type (RING finger) domain containing protein [Acanthamoeba castellanii str. Neff] >ELR24597.1 zinc finger, C3HC4 type (RING finger) domain containing protein [Acanthamoeba castellanii str. Neff]) HSP 1 Score: 72.8 bits (177), Expect = 1.800e-9 Identity = 30/61 (49.18%), Postives = 37/61 (60.66%), Query Frame = 0 Query: 131 KTAHVDKHCSICLADYEEGDTLCVLPCRHSYH------------DDCLDHWITAHSKCPLC 180 K D C+ICL DYEEGDTL LPC HSYH +DC+DHW+ +H+ CP+C Sbjct: 119 KADQEDNKCTICLCDYEEGDTLRALPCLHSYHKYRRLAISALEVEDCIDHWLKSHNTCPVC 179
BLAST of NO30G00430 vs. NCBI_GenBank
Match: XP_010846736.1 (PREDICTED: E3 ubiquitin-protein ligase RLIM-like [Bison bison bison]) HSP 1 Score: 72.0 bits (175), Expect = 3.200e-9 Identity = 24/43 (55.81%), Postives = 33/43 (76.74%), Query Frame = 0 Query: 137 KHCSICLADYEEGDTLCVLPCRHSYHDDCLDHWITAHSKCPLC 180 K CSIC+ +Y G+TL +LPC H YHD C+DHW++ H+ CP+C Sbjct: 576 KACSICITEYTTGNTLRILPCSHEYHDHCIDHWLSEHTNCPIC 618
BLAST of NO30G00430 vs. NCBI_GenBank
Match: XP_005908867.1 (PREDICTED: E3 ubiquitin-protein ligase RLIM [Bos mutus] >ELR46825.1 hypothetical protein M91_00207 [Bos mutus]) HSP 1 Score: 71.6 bits (174), Expect = 4.100e-9 Identity = 24/43 (55.81%), Postives = 33/43 (76.74%), Query Frame = 0 Query: 137 KHCSICLADYEEGDTLCVLPCRHSYHDDCLDHWITAHSKCPLC 180 K CSIC+ +Y G+TL +LPC H YHD C+DHW++ H+ CP+C Sbjct: 576 KACSICITEYTTGNTLRILPCSHEYHDHCIDHWLSEHTTCPIC 618 The following BLAST results are available for this feature:
BLAST of NO30G00430 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 20
Pagesback to topRelationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO30G00430 ID=NO30G00430|Name=NO30G00430|organism=Nannochloropsis oceanica|type=gene|length=1112bpback to top protein sequence of NO30G00430.1 >NO30G00430.1-protein ID=NO30G00430.1-protein|Name=NO30G00430.1|organism=Nannochloropsis oceanica|type=polypeptide|length=270bpback to top Synonyms
Publications
|