NO29G00980, NO29G00980 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO29G00980 vs. NCBI_GenBank
Match: XP_005853456.1 (hypothetical protein NGA_0473610, partial [Nannochloropsis gaditana CCMP526] >EKU22905.1 hypothetical protein NGA_0473610, partial [Nannochloropsis gaditana CCMP526]) HSP 1 Score: 91.3 bits (225), Expect = 1.000e-14 Identity = 57/163 (34.97%), Postives = 83/163 (50.92%), Query Frame = 0 Query: 68 KNEKQGEQEDQKEEGVAWRSLADVSRQTVEAHVKRLNRHIIAGLSICGLYAVSSDGGKQAIDVLQRLWPNPSS----XXXXXXXXXXXXXXLTCSSRELTWLHMCTQSSQLTCRVGPSKGEVGAAIVLYQEGRGIGGEGGGGIKYPLVIWHSFLNVNFKVVLN 227 KN + ++ D +EE V W LADVSR+ VE HVK+L R ++ GLS+CGLYA++ + G A+ L+RL P +S ++ +L WLH+ S Q T RVGP GE+ V Q + V WHS ++V+ +V L+ Sbjct: 8 KNVNRKDRSDSEEEAVRWACLADVSRRRVELHVKQLTRLLVGGLSVCGLYAITPEPGTPAVTALKRLCPPFASSRGRRTPHEAFPASPQGHEPPAAHDLAWLHVNASSRQFTWRVGPPGGEMRPGEVTSQ----------ARLLSRFVPWHSIVHVDLEVGLS 160 The following BLAST results are available for this feature:
BLAST of NO29G00980 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 1
Relationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO29G00980 ID=NO29G00980|Name=NO29G00980|organism=Nannochloropsis oceanica|type=gene|length=2106bpback to top protein sequence of NO29G00980.1 >NO29G00980.1-protein ID=NO29G00980.1-protein|Name=NO29G00980.1|organism=Nannochloropsis oceanica|type=polypeptide|length=535bpback to top Synonyms
Publications
|