NO24G01340, NO24G01340 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO24G01340 vs. NCBI_GenBank
Match: EWM24345.1 (hypothetical protein Naga_100105g11 [Nannochloropsis gaditana]) HSP 1 Score: 122.1 bits (305), Expect = 1.600e-24 Identity = 56/67 (83.58%), Postives = 63/67 (94.03%), Query Frame = 0 Query: 1 MSISTNPVGKVWVENMFLWLGPLLLFVYKMLYEYLPFPAFAVCLIIPAIYLYRITKDLSPVEAADEL 68 MSISTNPVGKVWVENMFLWL PLLLF+YKMLYEYLP PAF CL+IPA+Y+YR+TK+LSPVEAADE+ Sbjct: 1 MSISTNPVGKVWVENMFLWLAPLLLFIYKMLYEYLPAPAFIACLVIPALYVYRVTKELSPVEAADEM 67
BLAST of NO24G01340 vs. NCBI_GenBank
Match: XP_005855584.1 (hypothetical protein NGA_0623800 [Nannochloropsis gaditana CCMP526] >EKU20776.1 hypothetical protein NGA_0623800 [Nannochloropsis gaditana CCMP526]) HSP 1 Score: 121.7 bits (304), Expect = 2.100e-24 Identity = 56/68 (82.35%), Postives = 64/68 (94.12%), Query Frame = 0 Query: 1 MSISTNPVGKVWVENMFLWLGPLLLFVYKMLYEYLPFPAFAVCLIIPAIYLYRITKDLSPVEAADELN 69 MSISTNPVGKVWVENMFLWL PLLLF+YKMLYEYLP PAF CL+IPA+Y+YR+TK+LSPVEAADE++ Sbjct: 1 MSISTNPVGKVWVENMFLWLAPLLLFIYKMLYEYLPPPAFIACLVIPALYVYRVTKELSPVEAADEMS 68 The following BLAST results are available for this feature:
BLAST of NO24G01340 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 2
Relationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO24G01340 ID=NO24G01340|Name=NO24G01340|organism=Nannochloropsis oceanica|type=gene|length=2743bpback to top protein sequence of NO24G01340.1 >NO24G01340.1-protein ID=NO24G01340.1-protein|Name=NO24G01340.1|organism=Nannochloropsis oceanica|type=polypeptide|length=167bpback to top Synonyms
Publications
|