NO22G01140, NO22G01140 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO22G01140 vs. NCBI_GenBank
Match: EWM21468.1 (hypothetical protein Naga_100019g32 [Nannochloropsis gaditana]) HSP 1 Score: 97.4 bits (241), Expect = 2.400e-17 Identity = 54/80 (67.50%), Postives = 59/80 (73.75%), Query Frame = 0 Query: 1 MPSIKILFFAAARELAGGVQQVVADVVPAPDGDGVLRLRDVRAHLAKTFPGLSPIIADVTLALNMEYVAVETEATLTVQA 81 MPSIKILFFAAAREL GGVQQV ++ P D GVL LRDVR +LA FP L IIADVTLALNM+YVA E+ L V A Sbjct: 1 MPSIKILFFAAARELVGGVQQVDVEIQPRADSSGVLYLRDVRTYLASAFPDLDSIIADVTLALNMQYVAA-VESLLCVDA 79
BLAST of NO22G01140 vs. NCBI_GenBank
Match: CBN74713.1 (conserved unknown protein [Ectocarpus siliculosus]) HSP 1 Score: 73.6 bits (179), Expect = 3.800e-10 Identity = 43/90 (47.78%), Postives = 59/90 (65.56%), Query Frame = 0 Query: 4 IKILFFAAARELAGGVQQVVADVVPAPDGDGVLRLRDVRAHLAKTFPGLSPIIADVTLALNMEYVAVETEATLTVQAGDEVALIPPISGG 94 +K+LFFA+ RE+AG + + +P D + +LR+ H+ + PGL P+ A VTLALN EY+ E +ATL + GDEVA IPPISGG Sbjct: 25 VKVLFFASCREMAGTKETSLE--LPG-DSSSIAQLRE---HIVEKLPGLQPVAATVTLALNQEYLDPEQDATL--KEGDEVAFIPPISGG 106
BLAST of NO22G01140 vs. NCBI_GenBank
Match: ETM01062.1 (molybdopterin converting factor, subunit 1 [Phytophthora parasitica]) HSP 1 Score: 67.0 bits (162), Expect = 3.500e-8 Identity = 39/90 (43.33%), Postives = 56/90 (62.22%), Query Frame = 0 Query: 4 IKILFFAAARELAGGVQQVVADVVPAPDGDGVLRLRDVRAHLAKTFPGLSPIIADVTLALNMEYVAVETEATLTVQAGDEVALIPPISGG 94 IK+L+FA+ARE G ++ ++ P+ DGV+ L +R L +P + I +TLA N+EY +E + +Q GDEVALIPPISGG Sbjct: 3 IKVLYFASAREEIGAREEKLS----LPETDGVVTLASLRCLLMDKYPQAAATIESITLARNLEY----SEDDVALQDGDEVALIPPISGG 84
BLAST of NO22G01140 vs. NCBI_GenBank
Match: XP_022838351.1 (Molybdopterin synthase/thiamin biosynthesis sulphur carrier, beta-grasp [Ostreococcus tauri] >CEF96876.1 Molybdopterin synthase/thiamin biosynthesis sulphur carrier, beta-grasp [Ostreococcus tauri] >OUS42410.1 hypothetical protein BE221DRAFT_61668 [Ostreococcus tauri]) HSP 1 Score: 65.1 bits (157), Expect = 1.300e-7 Identity = 39/93 (41.94%), Postives = 52/93 (55.91%), Query Frame = 0 Query: 1 MPSIKILFFAAARELAGGVQQVVADVVPAPDGDGVLRLRDVRAHLAKTFPGLSPIIADVTLALNMEYVAVETEATLTVQAGDEVALIPPISGG 94 MP + +L FA ARELA + + + PD D + D RA L FP LS ++ ALN YV + E V+AGDE+A++PPISGG Sbjct: 1 MPLLNVLLFARARELA----EASSTTLTLPD-DPPASVADARAELLTRFPQLSGVLQTSIFALNKTYVKRDDERVAIVRAGDELAVVPPISGG 88
BLAST of NO22G01140 vs. NCBI_GenBank
Match: KPL73992.1 (hypothetical protein AC812_14305 [Bellilinea caldifistulae]) HSP 1 Score: 63.5 bits (153), Expect = 3.900e-7 Identity = 38/93 (40.86%), Postives = 59/93 (63.44%), Query Frame = 0 Query: 1 MPSIKILFFAAARELAGGVQQVVADVVPAPDGDGVLRLRDVRAHLAKTFPGLSPIIADVTLALNMEYVAVETEATLTVQAGDEVALIPPISGG 94 M +IK+LFFA +EL G ++++ V+P P LR+ D++ L + FP ++ +A+V +A+N +Y A E +QAGDEVA PP+SGG Sbjct: 1 MGAIKVLFFAHLKELCGVDKEMI--VLPQP-----LRVADLKRLLGERFPLINERLANVLVAVNQQYAADED----WIQAGDEVAFFPPVSGG 82
BLAST of NO22G01140 vs. NCBI_GenBank
Match: WP_061917788.1 (molybdopterin converting factor subunit 1 [Bellilinea caldifistulae] >GAP11240.1 molybdopterin synthase subunit MoaE/molybdopterin synthase subunit MoaD [Bellilinea caldifistulae]) HSP 1 Score: 63.5 bits (153), Expect = 3.900e-7 Identity = 38/93 (40.86%), Postives = 59/93 (63.44%), Query Frame = 0 Query: 1 MPSIKILFFAAARELAGGVQQVVADVVPAPDGDGVLRLRDVRAHLAKTFPGLSPIIADVTLALNMEYVAVETEATLTVQAGDEVALIPPISGG 94 M +IK+LFFA +EL G ++++ V+P P LR+ D++ L + FP ++ +A+V +A+N +Y A E +QAGDEVA PP+SGG Sbjct: 4 MGAIKVLFFAHLKELCGVDKEMI--VLPQP-----LRVADLKRLLGERFPLINERLANVLVAVNQQYAADED----WIQAGDEVAFFPPVSGG 85
BLAST of NO22G01140 vs. NCBI_GenBank
Match: OEU22271.1 (hypothetical protein FRACYDRAFT_267217 [Fragilariopsis cylindrus CCMP1102]) HSP 1 Score: 62.4 bits (150), Expect = 8.700e-7 Identity = 41/96 (42.71%), Postives = 56/96 (58.33%), Query Frame = 0 Query: 1 MPSIKILFFAAARELAGGVQQVVADVVPAPDGDGVLRLRDVRAHLAKTFPGLSPIIAD---VTLALNMEYVAVETEATLTVQAGDEVALIPPISGG 94 M SI++LFFA+ARE AG + + ++ P L R LA +PGL+ ++ D +TLALN EYV L ++ GD +ALIPPISGG Sbjct: 1 MISIQVLFFASAREAAGDISKKCIELTPDEANTSSL-----RRLLALEYPGLASMVKDEENLTLALNEEYVT--RGQVLALKDGDTIALIPPISGG 89 The following BLAST results are available for this feature:
BLAST of NO22G01140 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 7
Relationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO22G01140 ID=NO22G01140|Name=NO22G01140|organism=Nannochloropsis oceanica|type=gene|length=282bpback to top protein sequence of NO22G01140.1 >NO22G01140.1-protein ID=NO22G01140.1-protein|Name=NO22G01140.1|organism=Nannochloropsis oceanica|type=polypeptide|length=94bpback to top Synonyms
Publications
|