NO20G01390, NO20G01390 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO20G01390 vs. NCBI_GenBank
Match: EWM22080.1 (anaphase-promoting complex subunit 11 [Nannochloropsis gaditana]) HSP 1 Score: 147.5 bits (371), Expect = 1.400e-32 Identity = 57/62 (91.94%), Postives = 60/62 (96.77%), Query Frame = 0 Query: 1 MKVKIQRWHGVATWRWDVNDERCGICYTAFEACCPDCNIPGDDCPPVWGRCNHAFHMHCIMK 63 MKVKI+RWH VATW+WDVNDERCGICYTAFEACCPDC+IPGDDCPPVWG CNHAFHMHCIMK Sbjct: 1 MKVKIKRWHAVATWQWDVNDERCGICYTAFEACCPDCHIPGDDCPPVWGGCNHAFHMHCIMK 62
BLAST of NO20G01390 vs. NCBI_GenBank
Match: POM58436.1 (Anaphase-promoting complex subunit 11 domain containing hypothetical protein [Phytophthora palmivora var. palmivora]) HSP 1 Score: 127.9 bits (320), Expect = 1.200e-26 Identity = 48/62 (77.42%), Postives = 54/62 (87.10%), Query Frame = 0 Query: 1 MKVKIQRWHGVATWRWDVNDERCGICYTAFEACCPDCNIPGDDCPPVWGRCNHAFHMHCIMK 63 MKV I+RWHGVATW+W V++E CGIC AFEACCPDC +PGD CPPVWG CNHAFHMHC+MK Sbjct: 1 MKVTIKRWHGVATWKWGVDEECCGICRYAFEACCPDCTMPGDGCPPVWGACNHAFHMHCLMK 62
BLAST of NO20G01390 vs. NCBI_GenBank
Match: POM65884.1 (Anaphase-promoting complex subunit 11 domain containing hypothetical protein [Phytophthora palmivora var. palmivora]) HSP 1 Score: 127.9 bits (320), Expect = 1.200e-26 Identity = 48/62 (77.42%), Postives = 54/62 (87.10%), Query Frame = 0 Query: 1 MKVKIQRWHGVATWRWDVNDERCGICYTAFEACCPDCNIPGDDCPPVWGRCNHAFHMHCIMK 63 MKV I+RWHGVATW+W V++E CGIC AFEACCPDC +PGD CPPVWG CNHAFHMHC+MK Sbjct: 1 MKVTIKRWHGVATWKWGVDEECCGICRYAFEACCPDCTMPGDGCPPVWGACNHAFHMHCLMK 62
BLAST of NO20G01390 vs. NCBI_GenBank
Match: OWZ10335.1 (Anaphase-promoting complex subunit 11 [Phytophthora megakarya]) HSP 1 Score: 126.7 bits (317), Expect = 2.600e-26 Identity = 47/62 (75.81%), Postives = 54/62 (87.10%), Query Frame = 0 Query: 1 MKVKIQRWHGVATWRWDVNDERCGICYTAFEACCPDCNIPGDDCPPVWGRCNHAFHMHCIMK 63 MKV I++WHGVATW+W V++E CGIC AFEACCPDC +PGD CPPVWG CNHAFHMHC+MK Sbjct: 1 MKVTIKKWHGVATWKWGVDEECCGICRYAFEACCPDCTMPGDGCPPVWGACNHAFHMHCLMK 62
BLAST of NO20G01390 vs. NCBI_GenBank
Match: XP_009521384.1 (hypothetical protein PHYSODRAFT_345071 [Phytophthora sojae] >EGZ26096.1 hypothetical protein PHYSODRAFT_345071 [Phytophthora sojae]) HSP 1 Score: 125.9 bits (315), Expect = 4.500e-26 Identity = 48/62 (77.42%), Postives = 53/62 (85.48%), Query Frame = 0 Query: 1 MKVKIQRWHGVATWRWDVNDERCGICYTAFEACCPDCNIPGDDCPPVWGRCNHAFHMHCIMK 63 MKV I+RWHGVATW W V++E CGIC AFEACCPDC +PGD CPPVWG CNHAFHMHC+MK Sbjct: 9 MKVTIKRWHGVATWTWGVDEECCGICRYAFEACCPDCAMPGDGCPPVWGACNHAFHMHCLMK 70
BLAST of NO20G01390 vs. NCBI_GenBank
Match: XP_008896325.1 (hypothetical protein PPTG_04211 [Phytophthora parasitica INRA-310] >ETI35990.1 hypothetical protein F443_17814 [Phytophthora parasitica P1569] >ETL82885.1 hypothetical protein L917_17069 [Phytophthora parasitica] >ETM36118.1 hypothetical protein L914_17139 [Phytophthora parasitica] >ETN18688.1 hypothetical protein PPTG_04211 [Phytophthora parasitica INRA-310] >ETO64709.1 hypothetical protein F444_17851 [Phytophthora parasitica P1976]) HSP 1 Score: 124.8 bits (312), Expect = 1.000e-25 Identity = 46/62 (74.19%), Postives = 54/62 (87.10%), Query Frame = 0 Query: 1 MKVKIQRWHGVATWRWDVNDERCGICYTAFEACCPDCNIPGDDCPPVWGRCNHAFHMHCIMK 63 MKV I+RWHGVATW+W V++E CGIC AFEACCP+C +PGD CPPVWG CNHAFHMHC++K Sbjct: 1 MKVTIKRWHGVATWKWGVDEECCGICRYAFEACCPECTMPGDGCPPVWGACNHAFHMHCLVK 62
BLAST of NO20G01390 vs. NCBI_GenBank
Match: ETK76225.1 (hypothetical protein L915_17343 [Phytophthora parasitica] >ETL29663.1 hypothetical protein L916_17236 [Phytophthora parasitica] >ETP05808.1 hypothetical protein F441_17691 [Phytophthora parasitica CJ01A1]) HSP 1 Score: 124.8 bits (312), Expect = 1.000e-25 Identity = 46/62 (74.19%), Postives = 54/62 (87.10%), Query Frame = 0 Query: 1 MKVKIQRWHGVATWRWDVNDERCGICYTAFEACCPDCNIPGDDCPPVWGRCNHAFHMHCIMK 63 MKV I+RWHGVATW+W V++E CGIC AFEACCP+C +PGD CPPVWG CNHAFHMHC++K Sbjct: 17 MKVTIKRWHGVATWKWGVDEECCGICRYAFEACCPECTMPGDGCPPVWGACNHAFHMHCLVK 78
BLAST of NO20G01390 vs. NCBI_GenBank
Match: ETP33918.1 (hypothetical protein F442_17671 [Phytophthora parasitica P10297]) HSP 1 Score: 124.8 bits (312), Expect = 1.000e-25 Identity = 46/62 (74.19%), Postives = 54/62 (87.10%), Query Frame = 0 Query: 1 MKVKIQRWHGVATWRWDVNDERCGICYTAFEACCPDCNIPGDDCPPVWGRCNHAFHMHCIMK 63 MKV I+RWHGVATW+W V++E CGIC AFEACCP+C +PGD CPPVWG CNHAFHMHC++K Sbjct: 17 MKVTIKRWHGVATWKWGVDEECCGICRYAFEACCPECTMPGDGCPPVWGACNHAFHMHCLVK 78
BLAST of NO20G01390 vs. NCBI_GenBank
Match: XP_020904846.1 (anaphase-promoting complex subunit 11-like [Exaiptasia pallida]) HSP 1 Score: 122.9 bits (307), Expect = 3.800e-25 Identity = 46/62 (74.19%), Postives = 52/62 (83.87%), Query Frame = 0 Query: 1 MKVKIQRWHGVATWRWDVNDERCGICYTAFEACCPDCNIPGDDCPPVWGRCNHAFHMHCIMK 63 MKVKI+RW GVATWRW ND+ CGIC AF+ CCPDC IPGDDCP VWG+C+H FHMHCI+K Sbjct: 1 MKVKIKRWIGVATWRWVANDDSCGICRMAFDGCCPDCKIPGDDCPLVWGKCSHVFHMHCILK 62
BLAST of NO20G01390 vs. NCBI_GenBank
Match: AAL13436.1 (anaphase promoting complex subunit 11 [Arabidopsis thaliana]) HSP 1 Score: 122.1 bits (305), Expect = 6.500e-25 Identity = 44/62 (70.97%), Postives = 50/62 (80.65%), Query Frame = 0 Query: 1 MKVKIQRWHGVATWRWDVNDERCGICYTAFEACCPDCNIPGDDCPPVWGRCNHAFHMHCIMK 63 MKVKI RWH VA+W WD DE CGIC AF+ CCPDC +PGDDCP +WG CNHAFH+HCI+K Sbjct: 1 MKVKILRWHAVASWTWDAQDETCGICRMAFDGCCPDCKLPGDDCPLIWGACNHAFHLHCILK 62 The following BLAST results are available for this feature:
BLAST of NO20G01390 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 20
Pagesback to topRelationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO20G01390 ID=NO20G01390|Name=NO20G01390|organism=Nannochloropsis oceanica|type=gene|length=1065bpback to top protein sequence of NO20G01390.1 >NO20G01390.1-protein ID=NO20G01390.1-protein|Name=NO20G01390.1|organism=Nannochloropsis oceanica|type=polypeptide|length=87bpback to top protein sequence of NO20G01390.2 >NO20G01390.2-protein ID=NO20G01390.2-protein|Name=NO20G01390.2|organism=Nannochloropsis oceanica|type=polypeptide|length=66bpback to top Synonyms
Publications
|