NO19G01070, NO19G01070 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO19G01070 vs. NCBI_GenBank
Match: KKY27379.1 (putative type 1 phosphatase regulator ypi1 [Diplodia seriata]) HSP 1 Score: 67.4 bits (163), Expect = 4.700e-8 Identity = 35/68 (51.47%), Postives = 42/68 (61.76%), Query Frame = 0 Query: 37 SSTGSATVVEDKAAAKEGEGGVLRLRLHP--RPHVKWDEKVIDNEHMNKKSSKRCCIFHKKRAFGESS 103 +S GS E + G LRLR P R H++W E V+DNE M KKSSK CCI+HK+R FGESS Sbjct: 17 ASNGSIVTTESGDSPLNLPSGTLRLRAEPVQRRHIQWAEDVVDNEGMGKKSSKVCCIYHKQREFGESS 84
BLAST of NO19G01070 vs. NCBI_GenBank
Match: XP_021337775.1 (protein phosphatase inhibitor 3 (I3) [Babesia microti strain RI] >SIO73708.1 protein phosphatase inhibitor 3 (I3) [Babesia microti strain RI]) HSP 1 Score: 67.4 bits (163), Expect = 4.700e-8 Identity = 35/71 (49.30%), Postives = 41/71 (57.75%), Query Frame = 0 Query: 32 MQAKPSSTGSATVVEDKAAAKEGEGGVLRLRLHPRPHVKWDEKVIDNEHMNKKSSKRCCIFHKKRAFGESS 103 M + T + T + +A + LRL P +V W E IDNEHMNKKSSKRCCIFHKKR ESS Sbjct: 1 MNGNRTITTTITTISTGVSANTEDSSTQLLRLIPERNVTWAEDTIDNEHMNKKSSKRCCIFHKKRNPDESS 71
BLAST of NO19G01070 vs. NCBI_GenBank
Match: OMP83648.1 (Type 1 phosphatases regulator YPI1 [Diplodia seriata]) HSP 1 Score: 67.4 bits (163), Expect = 4.700e-8 Identity = 35/68 (51.47%), Postives = 42/68 (61.76%), Query Frame = 0 Query: 37 SSTGSATVVEDKAAAKEGEGGVLRLRLHP--RPHVKWDEKVIDNEHMNKKSSKRCCIFHKKRAFGESS 103 +S GS E + G LRLR P R H++W E V+DNE M KKSSK CCI+HK+R FGESS Sbjct: 17 ASNGSIVTTESGDSPLNLPSGTLRLRAEPVQRRHIQWAEDVVDNEGMGKKSSKVCCIYHKQREFGESS 84
BLAST of NO19G01070 vs. NCBI_GenBank
Match: EJK64663.1 (hypothetical protein THAOC_14580, partial [Thalassiosira oceanica]) HSP 1 Score: 67.0 bits (162), Expect = 6.100e-8 Identity = 29/44 (65.91%), Postives = 37/44 (84.09%), Query Frame = 0 Query: 58 VLRLRLHPRPHVKWDEKVIDNEHMNKKSSKRCCIFHKKRAFGES 102 VLRL+L P+ +V W+ VIDNE + +KSSKRCCI+HK+RAFGES Sbjct: 54 VLRLQLRPQSNVSWETDVIDNEGLGRKSSKRCCIWHKQRAFGES 97
BLAST of NO19G01070 vs. NCBI_GenBank
Match: EKG21413.1 (hypothetical protein MPH_01272 [Macrophomina phaseolina MS6]) HSP 1 Score: 67.0 bits (162), Expect = 6.100e-8 Identity = 36/68 (52.94%), Postives = 42/68 (61.76%), Query Frame = 0 Query: 37 SSTGSATVVEDKAAAKEGEGGVLRLRLH--PRPHVKWDEKVIDNEHMNKKSSKRCCIFHKKRAFGESS 103 +S GS E A+ G LRLR R H++W E VIDNE M KKSSK CCI+HK+R FGESS Sbjct: 16 ASNGSIVTTEPAASPLSLPSGTLRLRAQASQRRHIQWAEDVIDNEGMGKKSSKVCCIYHKQREFGESS 83
BLAST of NO19G01070 vs. NCBI_GenBank
Match: EPT05475.1 (hypothetical protein FOMPIDRAFT_1021299 [Fomitopsis pinicola FP-58527 SS1]) HSP 1 Score: 67.0 bits (162), Expect = 6.100e-8 Identity = 40/86 (46.51%), Postives = 47/86 (54.65%), Query Frame = 0 Query: 25 VGGRGGHMQAKPSSTGSATVVEDKAAAKEGEG------GVLRLRLHP--RPHVKWDEKVIDNEHMNKKSSKRCCIFHKKRAFGESS 103 V RGG + PS + D +EG G G LRLR P RP V W E V+DNE M +KSSK CCI+HK +AF ESS Sbjct: 4 VATRGGPSTSAPSDGSRTITIHDSQPGEEGAGEGGEEVGRLRLRAAPRNRPRVVWREDVVDNEGMGRKSSKICCIYHKPKAFDESS 89
BLAST of NO19G01070 vs. NCBI_GenBank
Match: GAN09296.1 (pheromone-regulated membrane protein [Mucor ambiguus]) HSP 1 Score: 67.0 bits (162), Expect = 6.100e-8 Identity = 35/62 (56.45%), Postives = 42/62 (67.74%), Query Frame = 0 Query: 46 EDKAAAKEGEG-GVLRLR----LHPRPHVKWDEKVIDNEHMNKKSSKRCCIFHKKRAFGESS 103 ED ++ +GE GVLRLR R ++WDE VIDNEHMNKK +K CCI+HK A GESS Sbjct: 41 EDVVSSDDGENVGVLRLRGDMNARRRRVIQWDENVIDNEHMNKKKTKICCIYHKPHAIGESS 102
BLAST of NO19G01070 vs. NCBI_GenBank
Match: OQS04313.1 (mitogen-activated protein kinase, partial [Thraustotheca clavata]) HSP 1 Score: 66.6 bits (161), Expect = 8.000e-8 Identity = 31/71 (43.66%), Postives = 42/71 (59.15%), Query Frame = 0 Query: 32 MQAKPSSTGSATVVEDKAAAKEGEGGVLRLRLHPRPHVKWDEKVIDNEHMNKKSSKRCCIFHKKRAFGESS 103 M + G++ V + E V+ +RL PR HV +DE +DNE + +K S +CCIFHKKR FGESS Sbjct: 589 MSTSAPTQGTSRAVTSLTEEETKENEVVYMRLAPRAHVTFDESAVDNEFLGRKKSNKCCIFHKKREFGESS 659
BLAST of NO19G01070 vs. NCBI_GenBank
Match: OAD02034.1 (hypothetical protein MUCCIDRAFT_111384 [Mucor circinelloides f. lusitanicus CBS 277.49]) HSP 1 Score: 66.2 bits (160), Expect = 1.000e-7 Identity = 35/62 (56.45%), Postives = 42/62 (67.74%), Query Frame = 0 Query: 46 EDKAAAKEGEG-GVLRLR----LHPRPHVKWDEKVIDNEHMNKKSSKRCCIFHKKRAFGESS 103 ED ++ +GE GVLRLR R ++WDE VIDNEHMNKK +K CCI+HK A GESS Sbjct: 41 EDVVSSDDGEHVGVLRLRGDMNARRRRVIQWDENVIDNEHMNKKKTKICCIYHKPHAIGESS 102
BLAST of NO19G01070 vs. NCBI_GenBank
Match: XP_012895296.1 (uncharacterized protein [Blastocystis hominis] >CBK21248.2 unnamed protein product [Blastocystis hominis]) HSP 1 Score: 65.9 bits (159), Expect = 1.400e-7 Identity = 28/45 (62.22%), Postives = 34/45 (75.56%), Query Frame = 0 Query: 58 VLRLRLHPRPHVKWDEKVIDNEHMNKKSSKRCCIFHKKRAFGESS 103 + LRL RPHV+W E +DNEHMN+K SK+CCI+HK FGESS Sbjct: 48 IYELRL--RPHVRWTEDTVDNEHMNRKRSKKCCIYHKPHEFGESS 90 The following BLAST results are available for this feature:
BLAST of NO19G01070 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 20
Pagesback to topRelationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO19G01070 ID=NO19G01070|Name=NO19G01070|organism=Nannochloropsis oceanica|type=gene|length=486bpback to top protein sequence of NO19G01070.1 >NO19G01070.1-protein ID=NO19G01070.1-protein|Name=NO19G01070.1|organism=Nannochloropsis oceanica|type=polypeptide|length=162bpback to top Synonyms
Publications
|