NO19G00350, NO19G00350 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
Homology
BLAST of NO19G00350 vs. NCBI_GenBank
Match: XP_005854375.1 (hypothetical protein NGA_0222900 [Nannochloropsis gaditana CCMP526] >EKU21981.1 hypothetical protein NGA_0222900 [Nannochloropsis gaditana CCMP526] >EWM23522.1 hypothetical protein Naga_101879g1 [Nannochloropsis gaditana]) HSP 1 Score: 145.2 bits (365), Expect = 9.300e-32 Identity = 66/84 (78.57%), Postives = 70/84 (83.33%), Query Frame = 0 Query: 1 MPGFSLRGQDAWRNHPMLANGFKRPIPNFPLACGIFVGLVAVDWAYRAVNGDDHHHGGHASVTFEDDIDGPSTAVISEGKKGGH 85 MPGFSLR QDAWRNHPMLA+GFKRPIPNF LACGIF+GLVAVDWA +A+NGD HHH SVTF DDIDGPST VI E KG H Sbjct: 1 MPGFSLRSQDAWRNHPMLASGFKRPIPNFTLACGIFLGLVAVDWANKAINGDGHHHANPVSVTFVDDIDGPSTTVIEE-SKGSH 83 The following BLAST results are available for this feature:
BLAST of NO19G00350 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 1
Relationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO19G00350 ID=NO19G00350|Name=NO19G00350|organism=Nannochloropsis oceanica|type=gene|length=971bpback to top protein sequence of NO19G00350.1 >NO19G00350.1-protein ID=NO19G00350.1-protein|Name=NO19G00350.1|organism=Nannochloropsis oceanica|type=polypeptide|length=86bpback to top Synonyms
Publications
|