NO16G03130, NO16G03130 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO16G03130 vs. NCBI_GenBank
Match: XP_013066286.1 (PREDICTED: endoglucanase A-like [Biomphalaria glabrata]) HSP 1 Score: 77.0 bits (188), Expect = 3.700e-11 Identity = 36/63 (57.14%), Postives = 46/63 (73.02%), Query Frame = 0 Query: 35 QSLHPIFLSFHILYGAIVGGPREDDSHHDKCADFITNEVALDYSAGFQGAVAGLKQLSAQNIL 98 ++LH S +L GAIVGGP DDS+ D D++ NEVALDY+AGFQGA+AG+ L A+NIL Sbjct: 391 ENLHATTPSPQVLVGAIVGGPEADDSYADNREDYVLNEVALDYNAGFQGALAGIVHLQAKNIL 453
BLAST of NO16G03130 vs. NCBI_GenBank
Match: XP_013066285.1 (PREDICTED: endoglucanase A-like [Biomphalaria glabrata]) HSP 1 Score: 74.3 bits (181), Expect = 2.400e-10 Identity = 35/62 (56.45%), Postives = 44/62 (70.97%), Query Frame = 0 Query: 36 SLHPIFLSFHILYGAIVGGPREDDSHHDKCADFITNEVALDYSAGFQGAVAGLKQLSAQNIL 98 + H S +L GAIVGGP DDS+ DK D++ NEVALDY+AGFQGA+AG+ L +NIL Sbjct: 392 NFHATTPSPQVLVGAIVGGPEVDDSYEDKRDDYVLNEVALDYNAGFQGALAGIVHLQDKNIL 453
BLAST of NO16G03130 vs. NCBI_GenBank
Match: BAH22180.1 (beta-1,4-endoglucanase [Metaphire hilgendorfi]) HSP 1 Score: 71.6 bits (174), Expect = 1.600e-9 Identity = 30/50 (60.00%), Postives = 44/50 (88.00%), Query Frame = 0 Query: 43 SFHILYGAIVGGPREDDSHHDKCADFITNEVALDYSAGFQGAVAGLKQLS 93 ++ ILYGA+VGGP ++D+++D +D+I+NEVA DY+AGFQGAVAGL+ L+ Sbjct: 399 NYQILYGALVGGPDQNDNYNDARSDYISNEVACDYNAGFQGAVAGLRALT 448
BLAST of NO16G03130 vs. NCBI_GenBank
Match: EWM25871.1 (endo-beta- -glucanase [Nannochloropsis gaditana]) HSP 1 Score: 69.7 bits (169), Expect = 5.900e-9 Identity = 32/55 (58.18%), Postives = 40/55 (72.73%), Query Frame = 0 Query: 43 SFHILYGAIVGGPREDDSHHDKCADFITNEVALDYSAGFQGAVAGLKQLSAQNIL 98 S + LYGA+VGGP E D + D C D+ EV++DY+AGFQGAVAGLK LS +L Sbjct: 446 SANTLYGALVGGPDEKDMYLDDCRDYKHTEVSVDYNAGFQGAVAGLKHLSLMGLL 500
BLAST of NO16G03130 vs. NCBI_GenBank
Match: XP_013066281.1 (PREDICTED: endoglucanase A-like isoform X1 [Biomphalaria glabrata] >XP_013066282.1 PREDICTED: endoglucanase A-like isoform X1 [Biomphalaria glabrata]) HSP 1 Score: 69.3 bits (168), Expect = 7.700e-9 Identity = 33/70 (47.14%), Postives = 47/70 (67.14%), Query Frame = 0 Query: 28 PIDVQSLQSLHPIFLSFHILYGAIVGGPREDDSHHDKCADFITNEVALDYSAGFQGAVAGLKQLSAQNIL 98 P D + S P + +L GA+VGGP E+D + DK D++TNEVA DY+AGFQGA+A + L ++N+L Sbjct: 387 PCDWNNFNSAAP---NPQVLVGALVGGPDENDIYQDKRDDYVTNEVATDYNAGFQGALAAIIHLQSKNLL 453
BLAST of NO16G03130 vs. NCBI_GenBank
Match: CAB06786.1 (1,4-beta-glucanase, partial [Caldicellulosiruptor bescii DSM 6725]) HSP 1 Score: 68.9 bits (167), Expect = 1.000e-8 Identity = 35/75 (46.67%), Postives = 46/75 (61.33%), Query Frame = 0 Query: 25 HRRPIDVQSLQSLHPIFLSFHILYGAIVGGPREDDSHHDKCADFITNEVALDYSAGFQGAVAGLKQLSAQNILGD 100 H D QS+ S H H LYGA+VGGP DDS+ D ++++ NEVA DY+AGF GA+A + QL N + D Sbjct: 378 HSSWADSQSIPSYHR-----HTLYGALVGGPGSDDSYTDDISNYVNNEVACDYNAGFVGALAKMYQLYGGNPIPD 447
BLAST of NO16G03130 vs. NCBI_GenBank
Match: WP_013429868.1 (endoglucanase [Caldicellulosiruptor kronotskyensis] >ADQ45727.1 Cellulase., Cellulose 1,4-beta-cellobiosidase [Caldicellulosiruptor kronotskyensis 2002]) HSP 1 Score: 68.9 bits (167), Expect = 1.000e-8 Identity = 35/75 (46.67%), Postives = 46/75 (61.33%), Query Frame = 0 Query: 25 HRRPIDVQSLQSLHPIFLSFHILYGAIVGGPREDDSHHDKCADFITNEVALDYSAGFQGAVAGLKQLSAQNILGD 100 H D QS+ S H H LYGA+VGGP DDS+ D ++++ NEVA DY+AGF GA+A + QL N + D Sbjct: 410 HSSWADSQSIPSYHR-----HTLYGALVGGPGSDDSYTDDISNYVNNEVACDYNAGFVGALAKMYQLYGGNPIPD 479
BLAST of NO16G03130 vs. NCBI_GenBank
Match: 4DOD_A (Chain A, The Structure Of Cbescii Cela Gh9 Module >4DOE_A Chain A, The Liganded Structure Of Cbescii Cela Gh9 Module) HSP 1 Score: 68.9 bits (167), Expect = 1.000e-8 Identity = 35/75 (46.67%), Postives = 46/75 (61.33%), Query Frame = 0 Query: 25 HRRPIDVQSLQSLHPIFLSFHILYGAIVGGPREDDSHHDKCADFITNEVALDYSAGFQGAVAGLKQLSAQNILGD 100 H D QS+ S H H LYGA+VGGP DDS+ D ++++ NEVA DY+AGF GA+A + QL N + D Sbjct: 401 HSSWADSQSIPSYHR-----HTLYGALVGGPGSDDSYTDDISNYVNNEVACDYNAGFVGALAKMYQLYGGNPIPD 470
BLAST of NO16G03130 vs. NCBI_GenBank
Match: WP_015908250.1 (endoglucanase [Caldicellulosiruptor bescii] >ACM60955.1 glycoside hydrolase family 48 [Caldicellulosiruptor bescii DSM 6725] >SKC55185.1 cellulose 1,4-beta-cellobiosidase [Caldicellulosiruptor bescii] >SKC57848.1 cellulose 1,4-beta-cellobiosidase [Caldicellulosiruptor bescii] >SKC46820.1 cellulose 1,4-beta-cellobiosidase [Caldicellulosiruptor bescii] >SLL38652.1 cellulose 1,4-beta-cellobiosidase [Caldicellulosiruptor bescii] >SMR92788.1 cellulose 1,4-beta-cellobiosidase [Caldicellulosiruptor bescii] >SMR90553.1 cellulose 1,4-beta-cellobiosidase [Caldicellulosiruptor bescii] >SMR94896.1 cellulose 1,4-beta-cellobiosidase [Caldicellulosiruptor bescii] >SMR97986.1 cellulose 1,4-beta-cellobiosidase [Caldicellulosiruptor bescii] >PBC91287.1 cellulose 1,4-beta-cellobiosidase [Caldicellulosiruptor bescii] >PBD07085.1 cellulose 1,4-beta-cellobiosidase [Caldicellulosiruptor bescii] >PFH14403.1 cellulose 1,4-beta-cellobiosidase [Caldicellulosiruptor bescii] >PFH21414.1 cellulose 1,4-beta-cellobiosidase [Caldicellulosiruptor bescii] >PFH24499.1 cellulose 1,4-beta-cellobiosidase [Caldicellulosiruptor bescii] >PIF58930.1 cellulose 1,4-beta-cellobiosidase [Caldicellulosiruptor bescii] >PRX95132.1 cellulose 1,4-beta-cellobiosidase [Caldicellulosiruptor bescii]) HSP 1 Score: 68.9 bits (167), Expect = 1.000e-8 Identity = 35/75 (46.67%), Postives = 46/75 (61.33%), Query Frame = 0 Query: 25 HRRPIDVQSLQSLHPIFLSFHILYGAIVGGPREDDSHHDKCADFITNEVALDYSAGFQGAVAGLKQLSAQNILGD 100 H D QS+ S H H LYGA+VGGP DDS+ D ++++ NEVA DY+AGF GA+A + QL N + D Sbjct: 410 HSSWADSQSIPSYHR-----HTLYGALVGGPGSDDSYTDDISNYVNNEVACDYNAGFVGALAKMYQLYGGNPIPD 479
BLAST of NO16G03130 vs. NCBI_GenBank
Match: XP_013066371.1 (PREDICTED: endoglucanase E-4-like [Biomphalaria glabrata] >XP_013066372.1 PREDICTED: endoglucanase E-4-like [Biomphalaria glabrata]) HSP 1 Score: 68.2 bits (165), Expect = 1.700e-8 Identity = 29/51 (56.86%), Postives = 38/51 (74.51%), Query Frame = 0 Query: 45 HILYGAIVGGPREDDSHHDKCADFITNEVALDYSAGFQGAVAGLKQLSAQN 96 H+L GAIVGGP +D+HHD +D+I NEVA DY++GFQGA+A + L N Sbjct: 522 HVLIGAIVGGPEYNDNHHDLRSDYILNEVATDYNSGFQGALAAIVHLQMTN 572 The following BLAST results are available for this feature:
BLAST of NO16G03130 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 20
Pagesback to topRelationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO16G03130 ID=NO16G03130|Name=NO16G03130|organism=Nannochloropsis oceanica|type=gene|length=849bpback to top protein sequence of NO16G03130.1 >NO16G03130.1-protein ID=NO16G03130.1-protein|Name=NO16G03130.1|organism=Nannochloropsis oceanica|type=polypeptide|length=102bpback to top Synonyms
Publications
|