NO15G01100, NO15G01100 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO15G01100 vs. NCBI_GenBank
Match: CBN79518.1 (expressed unknown protein [Ectocarpus siliculosus]) HSP 1 Score: 75.9 bits (185), Expect = 3.800e-10 Identity = 44/89 (49.44%), Postives = 64/89 (71.91%), Query Frame = 0 Query: 4 STKSGKREMNPADAYRKEQRKKEIKKNKKDRKRVRELGAYVKDPDLLKVEMEKMEKMLTAGLLDHKLLGKLDQMRHLYPAIVKLHAKKK 93 +T+SG+REMNP DAYRK QRKKE++KNKK+RK+VRE A V++PDL+ E+++ME + AG L + +L +R + ++K KKK Sbjct: 5 TTRSGRREMNPTDAYRKLQRKKEVQKNKKERKKVREFSAMVRNPDLMVEEVQRMEVLDAAGKLSENDVKRLANLRVTHRVLLK---KKK 90
BLAST of NO15G01100 vs. NCBI_GenBank
Match: XP_020173428.1 (WW domain-binding protein 11 [Aegilops tauschii subsp. tauschii]) HSP 1 Score: 68.9 bits (167), Expect = 4.600e-8 Identity = 41/84 (48.81%), Postives = 55/84 (65.48%), Query Frame = 0 Query: 3 RSTKSGKREMNPADAYRKEQRKKEIKKNKKDRKRVRELGAYVKDPDLLKVEMEKMEKMLTAGLLDHKLLGKLDQMRHLYPAIVK 87 ++TK GK MNP DA+RKEQR+KE+K+N K+VRE+G KDPD +K ++EK+EKM G LD K Q+ Y +VK Sbjct: 2 KTTKGGK-VMNPTDAFRKEQRRKELKRNXXXXKKVREVGILKKDPDAIKDQIEKLEKMKADGALDKARKHKKRQLEDTYNLVVK 84
BLAST of NO15G01100 vs. NCBI_GenBank
Match: XP_003557433.1 (WW domain-binding protein 11 [Brachypodium distachyon] >KQK20473.1 hypothetical protein BRADI_1g54730v3 [Brachypodium distachyon]) HSP 1 Score: 67.8 bits (164), Expect = 1.000e-7 Identity = 40/84 (47.62%), Postives = 55/84 (65.48%), Query Frame = 0 Query: 3 RSTKSGKREMNPADAYRKEQRKKEIKKNKKDRKRVRELGAYVKDPDLLKVEMEKMEKMLTAGLLDHKLLGKLDQMRHLYPAIVK 87 ++TK GK MNP DA+RKEQR+KE+K+N K+VRE+G KDPD +K +++K+EKM G LD K Q+ Y +VK Sbjct: 2 KTTKGGK-VMNPTDAFRKEQRRKELKRNXXXXKKVREVGILKKDPDAIKDQIDKLEKMKADGALDKARKHKKRQLEDTYNLVVK 84
BLAST of NO15G01100 vs. NCBI_GenBank
Match: XP_010255922.1 (PREDICTED: WW domain-binding protein 11-like isoform X1 [Nelumbo nucifera]) HSP 1 Score: 67.4 bits (163), Expect = 1.300e-7 Identity = 39/84 (46.43%), Postives = 56/84 (66.67%), Query Frame = 0 Query: 3 RSTKSGKREMNPADAYRKEQRKKEIKKNKKDRKRVRELGAYVKDPDLLKVEMEKMEKMLTAGLLDHKLLGKLDQMRHLYPAIVK 87 ++TK GK MNP DAYRKE RKKE+K+NKK+R++VRE+G KDP+ ++ ++EK+E M G LD K Q+ ++K Sbjct: 2 KTTKGGK-VMNPTDAYRKELRKKELKRNKKERRKVREVGILKKDPETIRQQIEKLEMMKADGALDKARKHKKRQLEDTLSLVLK 84
BLAST of NO15G01100 vs. NCBI_GenBank
Match: XP_011087192.1 (WW domain-binding protein 11 isoform X1 [Sesamum indicum]) HSP 1 Score: 67.4 bits (163), Expect = 1.300e-7 Identity = 40/86 (46.51%), Postives = 56/86 (65.12%), Query Frame = 0 Query: 1 MGRSTKSGKREMNPADAYRKEQRKKEIKKNKKDRKRVRELGAYVKDPDLLKVEMEKMEKMLTAGLLDHKLLGKLDQMRHLYPAIVK 87 M ++TK GK MNP DAYRKE R KE+K+NKK+RK+VRE+G KDP+ L+ +++K+E M G LD K Q+ ++K Sbjct: 1 MVKTTKGGK-TMNPTDAYRKELRMKELKRNKKERKKVREVGILKKDPETLREQIQKLETMKADGALDKARKHKKRQLEDTLNLVIK 85
BLAST of NO15G01100 vs. NCBI_GenBank
Match: KFH63998.1 (hypothetical protein MVEG_09823 [Mortierella verticillata NRRL 6337]) HSP 1 Score: 67.0 bits (162), Expect = 1.700e-7 Identity = 45/78 (57.69%), Postives = 58/78 (74.36%), Query Frame = 0 Query: 1 MGRSTKSGKREMNPADAYRKEQRKKEIKKNKKDRKRVRELGAYVKDPDLLKVEMEKMEKMLTAGLLDHKLLGKLDQMR 79 MGR KSG R +NPAD YRKEQ KKEIKKNK+DRK+VRELG+ +KD +VE+ + E++ AG LD + L KL ++R Sbjct: 1 MGR--KSG-RSLNPADQYRKEQHKKEIKKNKQDRKKVRELGSAIKD-TTTEVELSQHEELEKAGKLDKEGLKKLAELR 74
BLAST of NO15G01100 vs. NCBI_GenBank
Match: XP_003525051.1 (PREDICTED: WW domain-binding protein 11-like [Glycine max] >KHN48648.1 WW domain-binding protein 11 [Glycine soja] >KRH56978.1 hypothetical protein GLYMA_05G031100 [Glycine max]) HSP 1 Score: 66.6 bits (161), Expect = 2.300e-7 Identity = 41/84 (48.81%), Postives = 54/84 (64.29%), Query Frame = 0 Query: 3 RSTKSGKREMNPADAYRKEQRKKEIKKNKKDRKRVRELGAYVKDPDLLKVEMEKMEKMLTAGLLDHKLLGKLDQMRHLYPAIVK 87 ++TK GK MNP DAYRKE RKKE+K+NKK K+VRE+G KDPD LK ++E +E M G LD K Q++ ++K Sbjct: 2 KTTKGGK-VMNPTDAYRKEIRKKELKRNKKXXKKVREVGILKKDPDQLKKQIENLEMMKADGALDKARKHKKRQLQDTLNLVIK 84
BLAST of NO15G01100 vs. NCBI_GenBank
Match: XP_010483978.1 (PREDICTED: WW domain-binding protein 11 [Camelina sativa]) HSP 1 Score: 64.7 bits (156), Expect = 8.700e-7 Identity = 38/84 (45.24%), Postives = 55/84 (65.48%), Query Frame = 0 Query: 3 RSTKSGKREMNPADAYRKEQRKKEIKKNKKDRKRVRELGAYVKDPDLLKVEMEKMEKMLTAGLLDHKLLGKLDQMRHLYPAIVK 87 ++TK GK MNP DA+RKEQRK+EIK+NKK+R++VRE+G KDP+ +K ++ K++ G LD K Q+ +VK Sbjct: 2 KTTKGGK-VMNPTDAFRKEQRKREIKRNKKERQKVREVGILKKDPEQIKEQIRKLDMSKAEGALDKARKHKKRQLEDTLKMVVK 84 The following BLAST results are available for this feature:
BLAST of NO15G01100 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 8
Relationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO15G01100 ID=NO15G01100|Name=NO15G01100|organism=Nannochloropsis oceanica|type=gene|length=1392bpback to top protein sequence of NO15G01100.1 >NO15G01100.1-protein ID=NO15G01100.1-protein|Name=NO15G01100.1|organism=Nannochloropsis oceanica|type=polypeptide|length=464bpback to top Synonyms
Publications
|