NO15G00480, NO15G00480 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO15G00480 vs. NCBI_GenBank
Match: OWW37805.1 (Ankyrin repeats (3 copies) family protein [Aspergillus niger]) HSP 1 Score: 64.3 bits (155), Expect = 8.600e-7 Identity = 35/95 (36.84%), Postives = 57/95 (60.00%), Query Frame = 0 Query: 92 TSIHQAAAR-GAVSLVNHFLESSCETLNARDTQGRTPLMHACQWGQYLVCRLLLDRNAHVNAVDFHRRNALYWTLVTSGASVKIVELLLERGVDV 186 T++H A AR G V + LE+ T N + QGRTPL++A Q V LLD+++ +A+D H +AL++ + + S++ ++ LL+ GVDV Sbjct: 330 TALHLAIARLGTVPAIQPLLEAEAST-NIKGRQGRTPLLYALYLEQEAVATALLDKDSDPHALDNHSFSALHYAVASRTISIQFIQRLLDAGVDV 423
BLAST of NO15G00480 vs. NCBI_GenBank
Match: SPB51486.1 (unnamed protein product [Aspergillus niger]) HSP 1 Score: 64.3 bits (155), Expect = 8.600e-7 Identity = 35/95 (36.84%), Postives = 57/95 (60.00%), Query Frame = 0 Query: 92 TSIHQAAAR-GAVSLVNHFLESSCETLNARDTQGRTPLMHACQWGQYLVCRLLLDRNAHVNAVDFHRRNALYWTLVTSGASVKIVELLLERGVDV 186 T++H A AR G V + LE+ T N + QGRTPL++A Q V LLD+++ +A+D H +AL++ + + S++ ++ LL+ GVDV Sbjct: 365 TALHLAIARLGTVPAIQPLLEAEAST-NIKGRQGRTPLLYALYLEQEAVATALLDKDSDPHALDNHSFSALHYAVASRTISIQFIQRLLDAGVDV 458 The following BLAST results are available for this feature:
BLAST of NO15G00480 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 2
Relationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO15G00480 ID=NO15G00480|Name=NO15G00480|organism=Nannochloropsis oceanica|type=gene|length=1904bpback to top protein sequence of NO15G00480.2 >NO15G00480.2-protein ID=NO15G00480.2-protein|Name=NO15G00480.2|organism=Nannochloropsis oceanica|type=polypeptide|length=225bpback to top protein sequence of NO15G00480.1 >NO15G00480.1-protein ID=NO15G00480.1-protein|Name=NO15G00480.1|organism=Nannochloropsis oceanica|type=polypeptide|length=353bpback to top Synonyms
Publications
|