NO14G00340, NO14G00340 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO14G00340 vs. NCBI_GenBank
Match: XP_005854641.1 (hypothetical protein NGA_0192700 [Nannochloropsis gaditana CCMP526] >EKU21717.1 hypothetical protein NGA_0192700 [Nannochloropsis gaditana CCMP526]) HSP 1 Score: 114.8 bits (286), Expect = 1.200e-21 Identity = 52/71 (73.24%), Postives = 62/71 (87.32%), Query Frame = 0 Query: 718 DLVGKVRVFLLEKWKGGWGQDVKASEYSRAVELLAQNNDQARRFLEDVSPSTPHLETLALAFIVVMRCGAF 789 D+ +VR FLLEKWK GWGQDVK E+++AVELL+Q+N AR FLEDV+PSTPH+ETLAL+FIVVMRCGAF Sbjct: 138 DITAQVRSFLLEKWKVGWGQDVKGKEFAKAVELLSQDNASARSFLEDVAPSTPHIETLALSFIVVMRCGAF 208
BLAST of NO14G00340 vs. NCBI_GenBank
Match: XP_005853500.1 (hypothetical protein NGA_0504500, partial [Nannochloropsis gaditana CCMP526] >EKU22863.1 hypothetical protein NGA_0504500, partial [Nannochloropsis gaditana CCMP526]) HSP 1 Score: 114.8 bits (286), Expect = 1.200e-21 Identity = 52/71 (73.24%), Postives = 62/71 (87.32%), Query Frame = 0 Query: 718 DLVGKVRVFLLEKWKGGWGQDVKASEYSRAVELLAQNNDQARRFLEDVSPSTPHLETLALAFIVVMRCGAF 789 D+ +VR FLLEKWK GWGQDVK E+++AVELL+Q+N AR FLEDV+PSTPH+ETLAL+FIVVMRCGAF Sbjct: 88 DITAQVRSFLLEKWKVGWGQDVKGKEFAKAVELLSQDNASARSFLEDVAPSTPHIETLALSFIVVMRCGAF 158
BLAST of NO14G00340 vs. NCBI_GenBank
Match: XP_005853499.1 (homing endonuclease rb16 2, partial [Nannochloropsis gaditana CCMP526] >EKU22862.1 homing endonuclease rb16 2, partial [Nannochloropsis gaditana CCMP526]) HSP 1 Score: 89.4 bits (220), Expect = 5.600e-14 Identity = 44/94 (46.81%), Postives = 57/94 (60.64%), Query Frame = 0 Query: 216 TSTFRGVRWSKQQGRWRVDVHYKGKDLFLAYFNDEIEAARVFDDAASTLYEDGVLLNFLPDGTPNPERRRGRRGIKVKARDPPPPWVVEKLQTL 310 TS +RG+RW K +W V + Y+GK L L YF+DE+ AA+ +D A LYE LLNFLP G NPER+R ++ R PPPW +K L Sbjct: 10 TSDYRGIRWHKCNRKWEVQIKYRGKKLSLGYFDDELVAAQCYDRRAKELYET-PLLNFLPGGKLNPERKRRVDPRSLRPRRIPPPWCADKFVPL 102
BLAST of NO14G00340 vs. NCBI_GenBank
Match: EWM24765.1 (homing endonuclease rb16 2, partial [Nannochloropsis gaditana]) HSP 1 Score: 89.4 bits (220), Expect = 5.600e-14 Identity = 44/94 (46.81%), Postives = 57/94 (60.64%), Query Frame = 0 Query: 216 TSTFRGVRWSKQQGRWRVDVHYKGKDLFLAYFNDEIEAARVFDDAASTLYEDGVLLNFLPDGTPNPERRRGRRGIKVKARDPPPPWVVEKLQTL 310 TS +RG+RW K +W V + Y+GK L L YF+DE+ AA+ +D A LYE LLNFLP G NPER+R ++ R PPPW +K L Sbjct: 10 TSDYRGIRWHKCNRKWEVQIKYRGKKLSLGYFDDELVAAQCYDRRAKELYET-PLLNFLPGGKLNPERKRRVDPRSLRPRRIPPPWCADKFVPL 102
BLAST of NO14G00340 vs. NCBI_GenBank
Match: XP_005854643.1 (homing endonuclease rb16 2, partial [Nannochloropsis gaditana CCMP526] >EKU21719.1 homing endonuclease rb16 2, partial [Nannochloropsis gaditana CCMP526]) HSP 1 Score: 87.0 bits (214), Expect = 2.800e-13 Identity = 42/89 (47.19%), Postives = 55/89 (61.80%), Query Frame = 0 Query: 216 TSTFRGVRWSKQQGRWRVDVHYKGKDLFLAYFNDEIEAARVFDDAASTLYEDGVLLNFLPDGTPNPERRRGRRGIKVKARDPPPPWVVE 305 TS +RG+RW K +W V + Y+GK L L YF+DE+ AA+ +D A LYE LLNFLP G NPER+R ++ R PPPW + Sbjct: 10 TSDYRGIRWHKCNRKWEVQIKYRGKKLSLGYFDDELVAAQCYDRRAKELYET-PLLNFLPGGKLNPERKRRVDPRSLRPRRIPPPWCAD 97 The following BLAST results are available for this feature:
BLAST of NO14G00340 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 5
Relationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO14G00340 ID=NO14G00340|Name=NO14G00340|organism=Nannochloropsis oceanica|type=gene|length=3059bpback to top protein sequence of NO14G00340.1 >NO14G00340.1-protein ID=NO14G00340.1-protein|Name=NO14G00340.1|organism=Nannochloropsis oceanica|type=polypeptide|length=791bpback to top Synonyms
Publications
|