NO12G00780, NO12G00780 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO12G00780 vs. NCBI_GenBank
Match: XP_005856041.1 (uroporphyrinogen 3 C-methyltransferase [Nannochloropsis gaditana CCMP526] >EKU20334.1 uroporphyrinogen 3 C-methyltransferase [Nannochloropsis gaditana CCMP526]) HSP 1 Score: 64.3 bits (155), Expect = 6.600e-7 Identity = 27/38 (71.05%), Postives = 31/38 (81.58%), Query Frame = 0 Query: 42 IHQVFDRRLNFSNISTDASLYSMLRAWVQDDPLRQPPW 80 IH++ RR+NF +S DASLYSMLRAWVQDDP RQ PW Sbjct: 549 IHEILGRRVNFDALSADASLYSMLRAWVQDDPTRQVPW 586 The following BLAST results are available for this feature:
BLAST of NO12G00780 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 1
Relationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO12G00780 ID=NO12G00780|Name=NO12G00780|organism=Nannochloropsis oceanica|type=gene|length=813bpback to top protein sequence of NO12G00780.1 >NO12G00780.1-protein ID=NO12G00780.1-protein|Name=NO12G00780.1|organism=Nannochloropsis oceanica|type=polypeptide|length=271bpback to top Synonyms
Publications
|