NO12G00180, NO12G00180 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO12G00180 vs. NCBI_GenBank
Match: XP_005855374.1 (c2h2 zinc finger protein, partial [Nannochloropsis gaditana CCMP526] >EKU20986.1 c2h2 zinc finger protein, partial [Nannochloropsis gaditana CCMP526]) HSP 1 Score: 83.2 bits (204), Expect = 2.000e-12 Identity = 35/48 (72.92%), Postives = 42/48 (87.50%), Query Frame = 0 Query: 292 SGLAQTVAELLMNYQPSSCERRPFYCRICRYQGNNIDDLKEHKKSEMH 340 +GLAQTVAELL NYQP+S ERRPFYCRICR+QG +++DL HKK E+H Sbjct: 1 AGLAQTVAELLSNYQPASSERRPFYCRICRFQGQSLEDLAHHKKGELH 48
BLAST of NO12G00180 vs. NCBI_GenBank
Match: EWM26007.1 (c2h2 zinc finger [Nannochloropsis gaditana]) HSP 1 Score: 80.9 bits (198), Expect = 1.000e-11 Identity = 34/46 (73.91%), Postives = 40/46 (86.96%), Query Frame = 0 Query: 294 LAQTVAELLMNYQPSSCERRPFYCRICRYQGNNIDDLKEHKKSEMH 340 LAQTVAELL NYQP+S ERRPFYCRICR+QG +++DL HKK E+H Sbjct: 34 LAQTVAELLSNYQPASSERRPFYCRICRFQGQSLEDLAHHKKGELH 79 The following BLAST results are available for this feature:
BLAST of NO12G00180 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 2
Relationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO12G00180 ID=NO12G00180|Name=NO12G00180|organism=Nannochloropsis oceanica|type=gene|length=1884bpback to top protein sequence of NO12G00180.1 >NO12G00180.1-protein ID=NO12G00180.1-protein|Name=NO12G00180.1|organism=Nannochloropsis oceanica|type=polypeptide|length=401bpback to top Synonyms
Publications
|