NO09G01010, NO09G01010 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO09G01010 vs. NCBI_GenBank
Match: EWM27688.1 (signal recognition particle 9 kda protein [Nannochloropsis gaditana]) HSP 1 Score: 112.8 bits (281), Expect = 6.700e-22 Identity = 54/83 (65.06%), Postives = 65/83 (78.31%), Query Frame = 0 Query: 1 MTGAGEKCNTTKTASVEILQEHVVDLFARSGEKARLVLKYRHCDSKLSLRVTDDRKTAKYKTRRQAELNKIKRLVGLIITGKA 84 MTG G+K NTTK SV+ ++EHV DL AR GE+ R+VLKYRHCDSK SLRVTDD KT KY T RQ +++KI RL+GL + GKA Sbjct: 1 MTGTGKKVNTTKATSVDAMREHVADLLARGGERTRVVLKYRHCDSKASLRVTDDWKTVKYTTNRQIDVSKITRLLGLAVQGKA 83 The following BLAST results are available for this feature:
BLAST of NO09G01010 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 1
Relationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO09G01010 ID=NO09G01010|Name=NO09G01010|organism=Nannochloropsis oceanica|type=gene|length=339bpback to top protein sequence of NO09G01010.1 >NO09G01010.1-protein ID=NO09G01010.1-protein|Name=NO09G01010.1|organism=Nannochloropsis oceanica|type=polypeptide|length=113bpback to top Synonyms
Publications
|