NO08G02570, NO08G02570 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO08G02570 vs. NCBI_GenBank
Match: EWM26644.1 (hypothetical protein Naga_100001g165 [Nannochloropsis gaditana]) HSP 1 Score: 78.6 bits (192), Expect = 2.100e-11 Identity = 37/40 (92.50%), Postives = 39/40 (97.50%), Query Frame = 0 Query: 89 SRSVDVDTIIESIFSTTGDARLPQPVPLSQMIDLLVDFWE 129 +RSVDVD +IESIFSTTGDARLPQPVPLSQMIDLLVDFWE Sbjct: 68 ARSVDVDHVIESIFSTTGDARLPQPVPLSQMIDLLVDFWE 107 The following BLAST results are available for this feature:
BLAST of NO08G02570 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 1
Relationships
This gene is member of the following syntenic_region feature(s):
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
The following polypeptide feature(s) derives from this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO08G02570 ID=NO08G02570|Name=NO08G02570|organism=Nannochloropsis oceanica|type=gene|length=2448bpback to top protein sequence of NO08G02570.1 >NO08G02570.1-protein ID=NO08G02570.1-protein|Name=NO08G02570.1|organism=Nannochloropsis oceanica|type=polypeptide|length=151bpback to top protein sequence of NO08G02570.2 >NO08G02570.2-protein ID=NO08G02570.2-protein|Name=NO08G02570.2|organism=Nannochloropsis oceanica|type=polypeptide|length=135bpback to top protein sequence of NO08G02570.3 >NO08G02570.3-protein ID=NO08G02570.3-protein|Name=NO08G02570.3|organism=Nannochloropsis oceanica|type=polypeptide|length=183bpback to top protein sequence of NO08G02570.4 >NO08G02570.4-protein ID=NO08G02570.4-protein|Name=NO08G02570.4|organism=Nannochloropsis oceanica|type=polypeptide|length=167bpback to top protein sequence of NO08G02570.5 >NO08G02570.5-protein ID=NO08G02570.5-protein|Name=NO08G02570.5|organism=Nannochloropsis oceanica|type=polypeptide|length=105bpback to top Synonyms
Publications
|