NO06G04320, NO06G04320 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO06G04320 vs. NCBI_GenBank
Match: EWM26450.1 (60s acidic ribosomal protein p2 [Nannochloropsis gaditana]) HSP 1 Score: 99.4 bits (246), Expect = 8.000e-18 Identity = 50/61 (81.97%), Postives = 58/61 (95.08%), Query Frame = 0 Query: 1 MRHLATYLLLKLGGNDSPSASDVSTALSAVGVETDEARLSTLITELEGKDVDTLIKEGSEL 62 MRHLATYLLLKLGGN++PSASDV+TALSAVGVE DE RLSTL+ +LEGKDV+TLI+EGS+L Sbjct: 20 MRHLATYLLLKLGGNENPSASDVTTALSAVGVEADEGRLSTLLKDLEGKDVETLIEEGSKL 80
BLAST of NO06G04320 vs. NCBI_GenBank
Match: XP_005854766.1 (s-adenosylmethionine mitochondrial carrier protein [Nannochloropsis gaditana CCMP526] >XP_005855414.1 s-adenosylmethionine mitochondrial carrier protein [Nannochloropsis gaditana CCMP526] >EKU20945.1 s-adenosylmethionine mitochondrial carrier protein [Nannochloropsis gaditana CCMP526] >EKU21593.1 s-adenosylmethionine mitochondrial carrier protein [Nannochloropsis gaditana CCMP526]) HSP 1 Score: 96.7 bits (239), Expect = 5.200e-17 Identity = 49/61 (80.33%), Postives = 57/61 (93.44%), Query Frame = 0 Query: 1 MRHLATYLLLKLGGNDSPSASDVSTALSAVGVETDEARLSTLITELEGKDVDTLIKEGSEL 62 MRHLATYLLLKLGGN++PSASDV+TALSAVGVE DE LSTL+ +LEGKDV+TLI+EGS+L Sbjct: 1 MRHLATYLLLKLGGNENPSASDVTTALSAVGVEADEGLLSTLLKDLEGKDVETLIEEGSKL 61
BLAST of NO06G04320 vs. NCBI_GenBank
Match: KPA43555.1 (60s acidic ribosomal protein p2 [Fusarium langsethiae]) HSP 1 Score: 87.4 bits (215), Expect = 3.100e-14 Identity = 44/64 (68.75%), Postives = 52/64 (81.25%), Query Frame = 0 Query: 1 MRHLATYLLLKLGGNDSPSASDVSTALSAVGVETDEARLSTLITELEGKDVDTLIKEGSELLAT 65 M+HLA YLLL LGGN SPSA+DV T L +VG+E DE RL+TLI+ELEGKD+ LI EGSE LA+ Sbjct: 1 MKHLAAYLLLGLGGNTSPSAADVKTVLESVGIEADEERLNTLISELEGKDIQQLISEGSEKLAS 64
BLAST of NO06G04320 vs. NCBI_GenBank
Match: GAX27390.1 (large subunit ribosomal protein LP2 [Fistulifera solaris] >GAX21211.1 large subunit ribosomal protein LP2 [Fistulifera solaris]) HSP 1 Score: 86.7 bits (213), Expect = 5.400e-14 Identity = 43/65 (66.15%), Postives = 52/65 (80.00%), Query Frame = 0 Query: 1 MRHLATYLLLKLGGNDSPSASDVSTALSAVGVETDEARLSTLITELEGKDVDTLIKEGSELLATF 66 MRHLA YLLLKLGGNDSPSA D++ AL +VGVE D A LS L+ ELEGKD++ ++ G E+LATF Sbjct: 1 MRHLAAYLLLKLGGNDSPSADDITKALGSVGVEVDSASLSKLMGELEGKDLNEILATGKEMLATF 65
BLAST of NO06G04320 vs. NCBI_GenBank
Match: KFY79261.1 (hypothetical protein V498_08956 [Pseudogymnoascus sp. VKM F-4517 (FW-2822)]) HSP 1 Score: 85.5 bits (210), Expect = 1.200e-13 Identity = 43/64 (67.19%), Postives = 51/64 (79.69%), Query Frame = 0 Query: 1 MRHLATYLLLKLGGNDSPSASDVSTALSAVGVETDEARLSTLITELEGKDVDTLIKEGSELLAT 65 M+HLA YLLL LGGN+SPSASDVS LS+VG+E D RL LI EL+GKD++TLI EGS LA+ Sbjct: 1 MKHLAAYLLLALGGNESPSASDVSAVLSSVGIEADSERLDALIAELKGKDINTLISEGSAKLAS 64
BLAST of NO06G04320 vs. NCBI_GenBank
Match: KZV68042.1 (ribosomal protein 60S [Peniophora sp. CONT]) HSP 1 Score: 85.5 bits (210), Expect = 1.200e-13 Identity = 45/64 (70.31%), Postives = 52/64 (81.25%), Query Frame = 0 Query: 1 MRHLATYLLLKLGGNDSPSASDVSTALSAVGVETDEARLSTLITELEGKDVDTLIKEGSELLAT 65 MRHLA YLLL++GGN SPSA+DV LSAVG+E DE RLSTLI+ELEGKDV LI EG+ LA+ Sbjct: 1 MRHLAAYLLLQVGGNASPSAADVKKVLSAVGIEADEDRLSTLISELEGKDVAALINEGAGKLAS 64
BLAST of NO06G04320 vs. NCBI_GenBank
Match: EME50007.1 (hypothetical protein DOTSEDRAFT_68758 [Dothistroma septosporum NZE10]) HSP 1 Score: 85.1 bits (209), Expect = 1.600e-13 Identity = 42/64 (65.62%), Postives = 52/64 (81.25%), Query Frame = 0 Query: 1 MRHLATYLLLKLGGNDSPSASDVSTALSAVGVETDEARLSTLITELEGKDVDTLIKEGSELLAT 65 M+HLA YLLL+LGGN SPSA D+ LSAVG+E +E RLSTL++ELEGKD++ LI EGS LA+ Sbjct: 1 MKHLAAYLLLQLGGNTSPSAGDIKEVLSAVGIEAEEERLSTLLSELEGKDINELISEGSAKLAS 64
BLAST of NO06G04320 vs. NCBI_GenBank
Match: XP_023458685.1 (60S acidic ribosomal protein P2 [Cercospora beticola] >PIB01024.1 60S acidic ribosomal protein P2 [Cercospora beticola] >PPJ53457.1 hypothetical protein CBER1_00369 [Cercospora berteroae]) HSP 1 Score: 85.1 bits (209), Expect = 1.600e-13 Identity = 42/64 (65.62%), Postives = 54/64 (84.38%), Query Frame = 0 Query: 1 MRHLATYLLLKLGGNDSPSASDVSTALSAVGVETDEARLSTLITELEGKDVDTLIKEGSELLAT 65 M+HLA YLLL LGGN+SPSA+D+ + LSAVGVE D+ RL+ LI+ELEGKD++ LI EGS+ LA+ Sbjct: 1 MKHLAAYLLLGLGGNESPSAADIKSVLSAVGVEADDERLNKLISELEGKDINELIAEGSQKLAS 64
BLAST of NO06G04320 vs. NCBI_GenBank
Match: XP_007865193.1 (ribosomal protein 60S [Gloeophyllum trabeum ATCC 11539] >EPQ56465.1 ribosomal protein 60S [Gloeophyllum trabeum ATCC 11539]) HSP 1 Score: 84.7 bits (208), Expect = 2.000e-13 Identity = 44/64 (68.75%), Postives = 50/64 (78.12%), Query Frame = 0 Query: 1 MRHLATYLLLKLGGNDSPSASDVSTALSAVGVETDEARLSTLITELEGKDVDTLIKEGSELLAT 65 MRHLA YLLL++GGN SPSA DV LSAVG+E DE RL LI+ELEGKDV+ LI EGS LA+ Sbjct: 1 MRHLAAYLLLQIGGNASPSAEDVKKVLSAVGIEADEERLGKLISELEGKDVNALIAEGSSKLAS 64
BLAST of NO06G04320 vs. NCBI_GenBank
Match: KIK47394.1 (hypothetical protein CY34DRAFT_247207 [Suillus luteus UH-Slu-Lm8-n1]) HSP 1 Score: 84.7 bits (208), Expect = 2.000e-13 Identity = 42/64 (65.62%), Postives = 52/64 (81.25%), Query Frame = 0 Query: 1 MRHLATYLLLKLGGNDSPSASDVSTALSAVGVETDEARLSTLITELEGKDVDTLIKEGSELLAT 65 MRH+A YLLL++GGN SPSA DV LSAVG+E D+ RL TLI+ELEGKD++TLI EGS L++ Sbjct: 1 MRHIAAYLLLQIGGNASPSADDVKKVLSAVGIEADDDRLDTLISELEGKDINTLIAEGSAKLSS 64 The following BLAST results are available for this feature:
BLAST of NO06G04320 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 20
Pagesback to topRelationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO06G04320 ID=NO06G04320|Name=NO06G04320|organism=Nannochloropsis oceanica|type=gene|length=592bpback to top protein sequence of NO06G04320.1 >NO06G04320.1-protein ID=NO06G04320.1-protein|Name=NO06G04320.1|organism=Nannochloropsis oceanica|type=polypeptide|length=117bpback to top Synonyms
Publications
|