NO06G03920, NO06G03920 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO06G03920 vs. NCBI_GenBank
Match: XP_001689911.1 (predicted protein [Chlamydomonas reinhardtii] >PNW88129.1 hypothetical protein CHLRE_01g015500v5 [Chlamydomonas reinhardtii]) HSP 1 Score: 68.6 bits (166), Expect = 5.800e-8 Identity = 43/111 (38.74%), Postives = 62/111 (55.86%), Query Frame = 0 Query: 16 ARGLRNVEILGLKQDPYLRLRAGNQVFQTCVVKDGGGMASWNESFQIPIPNVTEREFLFLTVLDHNTLTDDTEIGSAKLSLIDVSSQ-FQVGCFDIFDKHANKVGVVDLAL 126 A+GL++ + G KQDPY++LR GNQ ++ DGG W E+F+ I N E LT++D +TLT D IG+A +SL Q +V ++ KH G V L+L Sbjct: 15 AKGLKDQDWFG-KQDPYVKLRLGNQERRSRTCIDGGKNPVWEETFEFGIINENTLE---LTLMDEDTLTRDDLIGTATISLARTREQGHEVVQAPVYTKHYKAKGFVQLSL 121
BLAST of NO06G03920 vs. NCBI_GenBank
Match: CBJ33001.1 (conserved unknown protein [Ectocarpus siliculosus]) HSP 1 Score: 68.2 bits (165), Expect = 7.500e-8 Identity = 44/123 (35.77%), Postives = 67/123 (54.47%), Query Frame = 0 Query: 9 LHVQARAARGLRNVEILGLKQDPYLRL---RAGNQVFQTCVVKDGGGMASWNESFQIPIPNVTEREFLFLTVLDHNTLTDDTEIGSAKLSLIDVSSQFQVGCFDIFDKHANKVGVVDLALRLE 129 L++ A+ A+GL+NV+++G +QDPYL+L RAG +V +T V +DGG +A+WNE+F + NV E + N +TD IG K L Q I++ G V L R++ Sbjct: 10 LYIVAKEAKGLKNVQMIG-RQDPYLKLWVGRAGTKV-KTKVHEDGGKVATWNETFVFDLQNVDAEECFHFEAKNKN-VTDSKTIGMGKFPLKHFGPVAQATWHKIYNIKGKPAGEVLLEGRMD 129 The following BLAST results are available for this feature:
BLAST of NO06G03920 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 2
Relationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO06G03920 ID=NO06G03920|Name=NO06G03920|organism=Nannochloropsis oceanica|type=gene|length=1715bpback to top protein sequence of NO06G03920.1 >NO06G03920.1-protein ID=NO06G03920.1-protein|Name=NO06G03920.1|organism=Nannochloropsis oceanica|type=polypeptide|length=447bpback to top Synonyms
Publications
|