NO06G03090, NO06G03090 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO06G03090 vs. NCBI_GenBank
Match: EWM19988.1 (hypothetical protein Naga_102432g1 [Nannochloropsis gaditana]) HSP 1 Score: 67.0 bits (162), Expect = 8.200e-8 Identity = 39/68 (57.35%), Postives = 43/68 (63.24%), Query Frame = 0 Query: 96 PTGKGRVLRGAFSSATDTGARTSSRGESGKPLKGDYQPIGVVAAVAGSTAYGVHHLDQMEIKRIESES 164 PTGKGRVLRG FSS TG TSS E GK +Q IG V VAG+TA V DQ EIK IES++ Sbjct: 5 PTGKGRVLRGGFSSTAHTGPGTSSGEELGKKWATFFQGIGAVVGVAGATAVVVRTFDQTEIKYIESKA 72
BLAST of NO06G03090 vs. NCBI_GenBank
Match: EWM19937.1 (hypothetical protein Naga_102907g1 [Nannochloropsis gaditana]) HSP 1 Score: 65.9 bits (159), Expect = 1.800e-7 Identity = 38/68 (55.88%), Postives = 43/68 (63.24%), Query Frame = 0 Query: 96 PTGKGRVLRGAFSSATDTGARTSSRGESGKPLKGDYQPIGVVAAVAGSTAYGVHHLDQMEIKRIESES 164 PTGKGRVLRG FSS TG TS+ E GK +Q IG V VAG+TA V DQ EIK IES++ Sbjct: 5 PTGKGRVLRGGFSSTAHTGPGTSNGEELGKKWATFFQGIGAVVGVAGATAVVVRTFDQTEIKYIESKA 72
BLAST of NO06G03090 vs. NCBI_GenBank
Match: EWM20146.1 (hypothetical protein Naga_101508g1 [Nannochloropsis gaditana]) HSP 1 Score: 64.3 bits (155), Expect = 5.300e-7 Identity = 38/68 (55.88%), Postives = 42/68 (61.76%), Query Frame = 0 Query: 96 PTGKGRVLRGAFSSATDTGARTSSRGESGKPLKGDYQPIGVVAAVAGSTAYGVHHLDQMEIKRIESES 164 PTGKGRVLRG F S TG TSS E GK +Q IG V VAG+TA V DQ EIK IES++ Sbjct: 5 PTGKGRVLRGGFYSTAHTGPGTSSGEELGKKWATFFQGIGAVLGVAGATAVVVRTFDQTEIKYIESKA 72 The following BLAST results are available for this feature:
BLAST of NO06G03090 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 3
Relationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO06G03090 ID=NO06G03090|Name=NO06G03090|organism=Nannochloropsis oceanica|type=gene|length=651bpback to top protein sequence of NO06G03090.1 >NO06G03090.1-protein ID=NO06G03090.1-protein|Name=NO06G03090.1|organism=Nannochloropsis oceanica|type=polypeptide|length=217bpback to top Synonyms
Publications
|