NO05G05070, NO05G05070 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
Homology
BLAST of NO05G05070 vs. NCBI_GenBank
Match: PNW75098.1 (hypothetical protein CHLRE_12g496550v5 [Chlamydomonas reinhardtii]) HSP 1 Score: 72.0 bits (175), Expect = 4.200e-9 Identity = 31/47 (65.96%), Postives = 40/47 (85.11%), Query Frame = 0 Query: 313 AESKLRFRDGVVVASKGEKYLIEKITPDWDGGSRGKIKTKGKRGPGF 360 A+ K+R+ DG VV++KGEK++IEKI +WDGGSRGK+ TKGKRG GF Sbjct: 242 AQKKVRYLDGRVVSNKGEKFIIEKIGEEWDGGSRGKVYTKGKRGKGF 288
BLAST of NO05G05070 vs. NCBI_GenBank
Match: KXZ47386.1 (hypothetical protein GPECTOR_35g824 [Gonium pectorale]) HSP 1 Score: 70.5 bits (171), Expect = 1.200e-8 Identity = 31/45 (68.89%), Postives = 38/45 (84.44%), Query Frame = 0 Query: 316 KLRFRDGVVVASKGEKYLIEKITPDWDGGSRGKIKTKGKRGPGFV 361 K+R+ DG VV++KGEK++IEK DWDGGSRGK+ TKGKRG GFV Sbjct: 122 KVRYLDGRVVSTKGEKFIIEKTGEDWDGGSRGKVFTKGKRGKGFV 166
BLAST of NO05G05070 vs. NCBI_GenBank
Match: XP_002947940.1 (hypothetical protein VOLCADRAFT_88352 [Volvox carteri f. nagariensis] >EFJ50928.1 hypothetical protein VOLCADRAFT_88352 [Volvox carteri f. nagariensis]) HSP 1 Score: 70.1 bits (170), Expect = 1.600e-8 Identity = 29/45 (64.44%), Postives = 39/45 (86.67%), Query Frame = 0 Query: 316 KLRFRDGVVVASKGEKYLIEKITPDWDGGSRGKIKTKGKRGPGFV 361 K+R+ DG VV++KGEK++IEK + +WDGGSRGK+ TKGKRG GF+ Sbjct: 244 KVRYLDGRVVSTKGEKFIIEKTSEEWDGGSRGKVYTKGKRGKGFI 288
BLAST of NO05G05070 vs. NCBI_GenBank
Match: PNH10884.1 (hypothetical protein TSOC_002378 [Tetrabaena socialis]) HSP 1 Score: 69.3 bits (168), Expect = 2.700e-8 Identity = 29/46 (63.04%), Postives = 38/46 (82.61%), Query Frame = 0 Query: 314 ESKLRFRDGVVVASKGEKYLIEKITPDWDGGSRGKIKTKGKRGPGF 360 ESK+R+ +G +V+ KGEK++IEK +WDGGSRGK+ TKGKRG GF Sbjct: 260 ESKVRYLEGRIVSQKGEKFIIEKTAEEWDGGSRGKVFTKGKRGKGF 305
BLAST of NO05G05070 vs. NCBI_GenBank
Match: CBJ32294.1 (hypothetical protein Esi_0327_0015 [Ectocarpus siliculosus]) HSP 1 Score: 68.6 bits (166), Expect = 4.700e-8 Identity = 28/43 (65.12%), Postives = 35/43 (81.40%), Query Frame = 0 Query: 318 RFRDGVVVASKGEKYLIEKITPDWDGGSRGKIKTKGKRGPGFV 361 R+RDG VV + G K ++E + P+WDGGSRGK+KTKGKRG GFV Sbjct: 276 RYRDGKVVTTTGAKVIVETVKPEWDGGSRGKVKTKGKRGKGFV 318
BLAST of NO05G05070 vs. NCBI_GenBank
Match: PRW33324.1 (DNA ligase 4 [Chlorella sorokiniana]) HSP 1 Score: 68.6 bits (166), Expect = 4.700e-8 Identity = 30/45 (66.67%), Postives = 38/45 (84.44%), Query Frame = 0 Query: 316 KLRFRDGVVVASKGEKYLIEKITPDWDGGSRGKIKTKGKRGPGFV 361 K R+RDG +V+++GEKY+ EK P+WDGGSRGK+ TKGKRG GFV Sbjct: 266 KARYRDGALVSTRGEKYVFEK-GPEWDGGSRGKVYTKGKRGKGFV 309
BLAST of NO05G05070 vs. NCBI_GenBank
Match: PSC73823.1 (hypothetical protein C2E20_3197 [Micractinium conductrix]) HSP 1 Score: 64.7 bits (156), Expect = 6.700e-7 Identity = 29/46 (63.04%), Postives = 36/46 (78.26%), Query Frame = 0 Query: 315 SKLRFRDGVVVASKGEKYLIEKITPDWDGGSRGKIKTKGKRGPGFV 361 SK+R+RDG+V G+KY++ K DWDGGSRGK+ TKGKRG GFV Sbjct: 248 SKVRYRDGMVATRAGQKYVVGK-DEDWDGGSRGKVYTKGKRGKGFV 292
BLAST of NO05G05070 vs. NCBI_GenBank
Match: GAX73881.1 (hypothetical protein CEUSTIGMA_g1331.t1 [Chlamydomonas eustigma]) HSP 1 Score: 64.3 bits (155), Expect = 8.800e-7 Identity = 28/47 (59.57%), Postives = 37/47 (78.72%), Query Frame = 0 Query: 314 ESKLRFRDGVVV-ASKGEKYLIEKITPDWDGGSRGKIKTKGKRGPGF 360 + K+R+ +GV V KGEKY++E + +WDGGSRGK+KTKGKRG GF Sbjct: 240 DPKVRYHNGVPVHVRKGEKYVVEVVQEEWDGGSRGKVKTKGKRGKGF 286 The following BLAST results are available for this feature:
BLAST of NO05G05070 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 8
Relationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO05G05070 ID=NO05G05070|Name=NO05G05070|organism=Nannochloropsis oceanica|type=gene|length=2092bpback to top protein sequence of NO05G05070.1 >NO05G05070.1-protein ID=NO05G05070.1-protein|Name=NO05G05070.1|organism=Nannochloropsis oceanica|type=polypeptide|length=361bpback to top Synonyms
Publications
|