NO04G02170, NO04G02170 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
Homology
BLAST of NO04G02170 vs. NCBI_GenBank
Match: XP_024574593.1 (Uncharacterized conserved protein [Plasmopara halstedii] >CEG38224.1 Uncharacterized conserved protein [Plasmopara halstedii]) HSP 1 Score: 65.1 bits (157), Expect = 2.100e-7 Identity = 37/88 (42.05%), Postives = 47/88 (53.41%), Query Frame = 0 Query: 63 AVAHRAVGAAAGAFSGDSEAPQHHE----THPQQVMQQQQHAYGAPAGQQACSLDGQNFQACLQANPGNVDACTFLYEALQQCQRNSQ 147 AVAHRAVGA A +FSG S+APQH E +H QQ Q P Q C D + F CL +N ++ +C F + +QCQ Q Sbjct: 19 AVAHRAVGAVASSFSGGSDAPQHQESSISSHEQQAAQ--------PPQQNQCGADQRAFLECLNSNSNDISSCQFYLDQFKQCQLQQQ 98
BLAST of NO04G02170 vs. NCBI_GenBank
Match: GAX10587.1 (hypothetical protein FisN_14Lh085 [Fistulifera solaris]) HSP 1 Score: 65.1 bits (157), Expect = 2.100e-7 Identity = 38/84 (45.24%), Postives = 51/84 (60.71%), Query Frame = 0 Query: 63 AVAHRAVGAAAGAFSGDS--EAPQHHETHPQQVMQQQQHAYGAPAGQQACSLDGQNFQACLQANPGNVDACTFLYEALQQCQRN 145 A+AHRAVGA AG+F G+S EA + PQ + QQ P C++D Q F CLQ + G+ ++C FLY+ LQQCQ+N Sbjct: 68 AIAHRAVGAVAGSFGGNSSNEAAAPVQQQPQPMSQQ-------PMQGGVCAMDKQMFFDCLQQSKGDQESCRFLYDQLQQCQQN 144 The following BLAST results are available for this feature:
BLAST of NO04G02170 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 2 Position : 0 Zoom : x 1
Relationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO04G02170 ID=NO04G02170|Name=NO04G02170|organism=Nannochloropsis oceanica|type=gene|length=2661bpback to top protein sequence of NO04G02170.1 >NO04G02170.1-protein ID=NO04G02170.1-protein|Name=NO04G02170.1|organism=Nannochloropsis oceanica|type=polypeptide|length=149bpback to top Synonyms
Publications
|