NO04G02140, NO04G02140 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO04G02140 vs. NCBI_GenBank
Match: XP_005854297.1 (hypothetical protein NGA_2080720, partial [Nannochloropsis gaditana CCMP526] >XP_005855173.1 hypothetical protein NGA_2080710, partial [Nannochloropsis gaditana CCMP526] >EKU21187.1 hypothetical protein NGA_2080710, partial [Nannochloropsis gaditana CCMP526] >EKU22063.1 hypothetical protein NGA_2080720, partial [Nannochloropsis gaditana CCMP526]) HSP 1 Score: 112.1 bits (279), Expect = 1.000e-21 Identity = 52/84 (61.90%), Postives = 68/84 (80.95%), Query Frame = 0 Query: 11 HISQSMGSISSLIFDPATSINYDFVAGSYLVASIICLALAVASIFFEVSSVKGWWIALAPFPPSFLWSLIVRSRWQAGLKAAAK 95 +I +M + S + +P+ SINYDFVAGSY +AS++CLALAV+S+ FEVSSVKGWWIALAPFPP+ +WSLIVR+RW L++ K Sbjct: 8 NIKAAMIPLISSVLEPSPSINYDFVAGSYFIASLLCLALAVSSLVFEVSSVKGWWIALAPFPPALVWSLIVRARWHLALESKTK 91
BLAST of NO04G02140 vs. NCBI_GenBank
Match: EWM28605.1 (hypothetical protein Naga_100009g105 [Nannochloropsis gaditana]) HSP 1 Score: 112.1 bits (279), Expect = 1.000e-21 Identity = 52/84 (61.90%), Postives = 68/84 (80.95%), Query Frame = 0 Query: 11 HISQSMGSISSLIFDPATSINYDFVAGSYLVASIICLALAVASIFFEVSSVKGWWIALAPFPPSFLWSLIVRSRWQAGLKAAAK 95 +I +M + S + +P+ SINYDFVAGSY +AS++CLALAV+S+ FEVSSVKGWWIALAPFPP+ +WSLIVR+RW L++ K Sbjct: 109 NIKAAMIPLISSVLEPSPSINYDFVAGSYFIASLLCLALAVSSLVFEVSSVKGWWIALAPFPPALVWSLIVRARWHLALESKTK 192
BLAST of NO04G02140 vs. NCBI_GenBank
Match: CBN78956.1 (conserved unknown protein [Ectocarpus siliculosus]) HSP 1 Score: 67.4 bits (163), Expect = 2.800e-8 Identity = 30/62 (48.39%), Postives = 41/62 (66.13%), Query Frame = 0 Query: 26 PATSINYDFVAGSYLVASIICLALAVASIFFEVSSVKGWWIALAPFPPSFLWSLIVRSRWQA 88 P+ INY+FVAGSYLV S+I + L F V +V+G W+ APF P W+L++RS+W A Sbjct: 22 PSPGINYNFVAGSYLVCSLILVVLLALDKFLHVEAVEGSWVVFAPFLPCLAWALVIRSKWLA 83
BLAST of NO04G02140 vs. NCBI_GenBank
Match: POM64276.1 (Hypothetical protein PHPALM_20222 [Phytophthora palmivora var. palmivora]) HSP 1 Score: 65.9 bits (159), Expect = 8.300e-8 Identity = 35/75 (46.67%), Postives = 46/75 (61.33%), Query Frame = 0 Query: 24 FDPATSINYDFVAGSYLVASIICLALAVASIFFEVSSVKGWWIALAPFPPSFLWSLIVRSRWQAGLKAAAKSKEE 99 F P+ +INY+FVAG Y + +C L V + F V V+G++I L PF P FLWSL+VR RW A KS +E Sbjct: 4 FTPSPTINYNFVAGVYAFFTALCALLTV--LHFYVPQVEGFYIVLVPFVPCFLWSLVVRHRWLQQSTTAYKSVDE 76
BLAST of NO04G02140 vs. NCBI_GenBank
Match: OWZ18052.1 (hypothetical protein PHMEG_0007923 [Phytophthora megakarya]) HSP 1 Score: 62.8 bits (151), Expect = 7.000e-7 Identity = 31/63 (49.21%), Postives = 42/63 (66.67%), Query Frame = 0 Query: 23 IFDPATSINYDFVAGSYLVASIICLALAVASIFFEVSSVKGWWIALAPFPPSFLWSLIVRSRW 86 +F P+ +INYDFV G Y + + + LAV + F S V+G++I L PF P FLWSL+VR RW Sbjct: 3 VFKPSPTINYDFVVGVYAFFTAVFVLLAV--LHFYTSQVEGFYIVLVPFVPCFLWSLVVRHRW 63
BLAST of NO04G02140 vs. NCBI_GenBank
Match: XP_009519938.1 (hypothetical protein PHYSODRAFT_482848 [Phytophthora sojae] >EGZ24650.1 hypothetical protein PHYSODRAFT_482848 [Phytophthora sojae]) HSP 1 Score: 62.4 bits (150), Expect = 9.200e-7 Identity = 29/63 (46.03%), Postives = 43/63 (68.25%), Query Frame = 0 Query: 23 IFDPATSINYDFVAGSYLVASIICLALAVASIFFEVSSVKGWWIALAPFPPSFLWSLIVRSRW 86 +F P+ +INY+FVAG Y + +C+ L+V + F ++G++I L PF P FLWSL+VR RW Sbjct: 3 VFTPSPTINYNFVAGVYAFFTALCILLSV--LHFYTPQLEGFYIVLVPFVPCFLWSLVVRHRW 63 The following BLAST results are available for this feature:
BLAST of NO04G02140 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 6
Relationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO04G02140 ID=NO04G02140|Name=NO04G02140|organism=Nannochloropsis oceanica|type=gene|length=1943bpback to top protein sequence of NO04G02140.1 >NO04G02140.1-protein ID=NO04G02140.1-protein|Name=NO04G02140.1|organism=Nannochloropsis oceanica|type=polypeptide|length=99bpback to top Synonyms
Publications
|