NO03G05660, NO03G05660 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO03G05660 vs. NCBI_GenBank
Match: XP_024577888.1 (sec14 cytosolic [Plasmopara halstedii] >CEG41519.1 sec14 cytosolic [Plasmopara halstedii]) HSP 1 Score: 65.5 bits (158), Expect = 4.000e-7 Identity = 38/101 (37.62%), Postives = 54/101 (53.47%), Query Frame = 0 Query: 53 SEMLLEEEGGNFPRARKRHNATVRWRHHHRVDNIFDTGETPTPAAFAQILRIWPRWFQGRTRDGDVVMYEELGKLRGSSLREARLNPGAWSRHLALICEYV 154 S + E G+ + R R+ AT++WR + +DNI TP P F I R +P++F GRTRDG V YE GK+ +L+ L+ RH I EY+ Sbjct: 414 SPRFIAGEKGDEEKGRARYLATLKWRKENNIDNIL---VTPHP-NFEIIKRSYPQYFHGRTRDGHPVYYERPGKIDLPALKREGLSIDDLLRHYMYITEYL 510
BLAST of NO03G05660 vs. NCBI_GenBank
Match: OQR98714.1 (SEC14 cytosolic factor [Achlya hypogyna]) HSP 1 Score: 65.5 bits (158), Expect = 4.000e-7 Identity = 37/101 (36.63%), Postives = 56/101 (55.45%), Query Frame = 0 Query: 53 SEMLLEEEGGNFPRARKRHNATVRWRHHHRVDNIFDTGETPTPAAFAQILRIWPRWFQGRTRDGDVVMYEELGKLRGSSLREARLNPGAWSRHLALICEYV 154 S + E G+ + R R+ AT++WR +RVD I E P F I + +P++F GR+++G+ V YE+LGK+ L+ A LN RH I EY+ Sbjct: 456 SPRFVAAEKGDEAKGRARYEATLQWRRENRVDGIL-YEEQP---HFHLIKQCYPQYFHGRSKNGNCVYYEKLGKIDLKRLKGAGLNLDQLLRHYMYITEYL 552 The following BLAST results are available for this feature:
BLAST of NO03G05660 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 2
Relationships
This gene is member of the following syntenic_region feature(s):
This gene is orthologous to the following gene feature(s):
The following polypeptide feature(s) derives from this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO03G05660 ID=NO03G05660|Name=NO03G05660|organism=Nannochloropsis oceanica|type=gene|length=1169bpback to top protein sequence of NO03G05660.1 >NO03G05660.1-protein ID=NO03G05660.1-protein|Name=NO03G05660.1|organism=Nannochloropsis oceanica|type=polypeptide|length=365bpback to top Synonyms
Publications
|