NO02G05210, NO02G05210 (gene) Nannochloropsis oceanica
Overview
Properties
Mutants
Expression
Hover the mouse over a column in the graph to view expression values. Alignments
The following features are aligned
Analyses
This gene is derived from or has results from the following analyses
Annotated Terms
The following terms have been associated with this gene:
Homology
BLAST of NO02G05210 vs. NCBI_GenBank
Match: XP_009822452.1 (hypothetical protein H257_01115 [Aphanomyces astaci] >ETV87589.1 hypothetical protein H257_01115 [Aphanomyces astaci]) HSP 1 Score: 66.6 bits (161), Expect = 1.400e-7 Identity = 38/108 (35.19%), Postives = 60/108 (55.56%), Query Frame = 0 Query: 162 ILLQAMVGQQILVELKTNAEARGILEEADE-NMNLTLILAEHISSSGAVTQHPLPFLFLPGSAVRYVHLPPRLSIDKTIQRHVDALDFNSKRFQRGRLKPAPVGQAPP 269 +LLQ+M+G + +ELKT G +EE E NM++ L + S GA+ L +F+ G + +VHLP RL++ ++ ++ +D N +QR KPA APP Sbjct: 10 VLLQSMLGMDVKIELKTEYVLEGRVEEVGEGNMDVRLTNVKQTSPQGAIVH--LDEVFVMGKMILFVHLPDRLNVAVHLRDYMQMVDKNRSMYQRSTRKPATTPSAPP 115
BLAST of NO02G05210 vs. NCBI_GenBank
Match: OQS07619.1 (hypothetical protein THRCLA_20106 [Thraustotheca clavata]) HSP 1 Score: 64.7 bits (156), Expect = 5.400e-7 Identity = 31/100 (31.00%), Postives = 60/100 (60.00%), Query Frame = 0 Query: 162 ILLQAMVGQQILVELKTNAEARGILEEADENMNLTLILAEHISSSGAVTQHPLPFLFLPGSAVRYVHLPPRLSIDKTIQRHVDALDFNSKRFQRGRLKPA 262 I+LQ+M+G +++++LKT + +G +EE + M++ L I+ +G + L LF+ G + YVH+P R+ ++ ++ +V ++ N K + R KPA Sbjct: 12 IVLQSMLGMEVMIDLKTEYQLKGTIEEVGDGMDVRLSNVSQIAPNGKMLL--LDELFVMGKMILYVHIPDRIHLNTHLKEYVQMVERNKKMYNRAVRKPA 109 The following BLAST results are available for this feature:
BLAST of NO02G05210 vs. NCBI_GenBank
Analysis Date: 2019-07-11 (BLASTP analysis of N. oceanica IMET1 genes) Total hits: 2
Relationships
This gene is member of the following syntenic_region feature(s):
The following polypeptide feature(s) derives from this gene:
The following gene feature(s) are orthologous to this gene:
The following mRNA feature(s) are a part of this gene:
Sequences
The following sequences are available for this feature:
gene sequence >NO02G05210 ID=NO02G05210|Name=NO02G05210|organism=Nannochloropsis oceanica|type=gene|length=1041bpback to top protein sequence of NO02G05210.1 >NO02G05210.1-protein ID=NO02G05210.1-protein|Name=NO02G05210.1|organism=Nannochloropsis oceanica|type=polypeptide|length=291bpback to top Synonyms
Publications
|